Recombinant Human CHIC2 Protein, GST-Tagged
| Cat.No. : | CHIC2-1235H |
| Product Overview : | Human CHIC2 full-length ORF (AAH34691, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 43.78 kDa |
| AA Sequence : | MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHIC2 cysteine-rich hydrophobic domain 2 [ Homo sapiens ] |
| Official Symbol | CHIC2 |
| Synonyms | CHIC2; cysteine-rich hydrophobic domain 2; cysteine-rich hydrophobic domain 2 protein; BTL; BRX-like translocated in leukemia; cystein-rich hydrophobic domain 2; MGC21173; |
| Gene ID | 26511 |
| mRNA Refseq | NM_012110 |
| Protein Refseq | NP_036242 |
| MIM | 604332 |
| UniProt ID | Q9UKJ5 |
| ◆ Recombinant Proteins | ||
| CHIC2-11176H | Recombinant Human CHIC2 protein, GST-tagged | +Inquiry |
| CHIC2-3396M | Recombinant Mouse CHIC2 Protein | +Inquiry |
| CHIC2-671R | Recombinant Rhesus Macaque CHIC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHIC2-1235H | Recombinant Human CHIC2 Protein, GST-Tagged | +Inquiry |
| CHIC2-5177H | Recombinant Human CHIC2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHIC2-7537HCL | Recombinant Human CHIC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHIC2 Products
Required fields are marked with *
My Review for All CHIC2 Products
Required fields are marked with *
