Recombinant Human GPN1 protein, GST-tagged
Cat.No. : | GPN1-13429H |
Product Overview : | Recombinant Human GPN1 protein(66-374 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 66-374 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | ANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKYVLIDTPGQIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GPN1 GPN-loop GTPase 1 [ Homo sapiens ] |
Official Symbol | GPN1 |
Synonyms | GPN1; GPN-loop GTPase 1; XAB1, XPA binding protein 1 , XPA binding protein 1, GTPase; ATPBD1A; MBDIN; NTPBP; RNA polymerase II associated protein 4; RPAP4; XPA-binding protein 1; ATP(GTP)-binding protein; MBD2-interacting protein; XPA binding protein 1, GTPase; XAB1; FLJ51176; |
Gene ID | 11321 |
mRNA Refseq | NM_001145047 |
Protein Refseq | NP_001138519 |
MIM | 611479 |
UniProt ID | Q9HCN4 |
◆ Recombinant Proteins | ||
GPN1-13429H | Recombinant Human GPN1 protein, GST-tagged | +Inquiry |
GPN1-2242H | Recombinant Human GPN1 Protein, MYC/DDK-tagged | +Inquiry |
GPN1-6847H | Recombinant Human GPN-Loop GTPase 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPN1-1934HCL | Recombinant Human GPN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPN1 Products
Required fields are marked with *
My Review for All GPN1 Products
Required fields are marked with *