Recombinant Human GPN1 protein, GST-tagged

Cat.No. : GPN1-13429H
Product Overview : Recombinant Human GPN1 protein(66-374 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability December 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 66-374 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : ANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKYVLIDTPGQIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name GPN1 GPN-loop GTPase 1 [ Homo sapiens ]
Official Symbol GPN1
Synonyms GPN1; GPN-loop GTPase 1; XAB1, XPA binding protein 1 , XPA binding protein 1, GTPase; ATPBD1A; MBDIN; NTPBP; RNA polymerase II associated protein 4; RPAP4; XPA-binding protein 1; ATP(GTP)-binding protein; MBD2-interacting protein; XPA binding protein 1, GTPase; XAB1; FLJ51176;
Gene ID 11321
mRNA Refseq NM_001145047
Protein Refseq NP_001138519
MIM 611479
UniProt ID Q9HCN4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPN1 Products

Required fields are marked with *

My Review for All GPN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon