Active Recombinant Human NMNAT1, His-tagged

Cat.No. : NMNAT1-26H
Product Overview : Recombinant Human NMNAT1 fused with N-terminal His-tag, was expressed in an E.coli cell expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes an enzyme which catalyzes a key step in the biosynthesis of the coenzyme NAD. The encoded protein is one of several nicotinamide nucleotide adenylyltransferases. Studies in Drosophila and mammalian neurons have shown the encoded protein can confer protection to damaged neurons. This protection requires enzymatic activity which increases NAD levels and activates a nuclear deacetylase which is the protective molecule. Pseudogenes of this gene are located on chromosomes 1, 3, 4, 14 and 15.
Form : 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 256 mM imidazole and 20% glycerol
Bio-activity : 4200 pmol/min/μg Assay Conditions: The 50 μL reaction mixture contained 50 mM Tris-HCl, pH 7.4, 5 mM MgCl2, 0.1 mM NMN, 0.1 mM ATP, and various amounts of NMNAT.
Molecular Mass : 32.8 kDa
AA Sequence : MHHHHHHENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGD AYKKKGLIPAYHRVI MAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDC DHQQNSPTLERPGRKRKWTETQDSSQKKSLE PKTKAVPKVKLLCGADLLESFAVPNL WKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEW IANDISSTKIRRA LRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT
Purity : ≥95%
Applications : Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
Stability : >6 months at –80°C
Gene Name NMNAT1 nicotinamide nucleotide adenylyltransferase 1 [ Homo sapiens (human) ]
Official Symbol NMNAT1
Synonyms NMNAT1; LCA9; NMNAT; PNAT1; nicotinamide nucleotide adenylyltransferase 1; NMN adenylyltransferase 1; NaMN adenylyltransferase 1; pyridine nucleotide adenylyltransferase 1; nicotinate-nucleotide adenylyltransferase 1; EC 2.7.7.1; EC 2.7.7.18
Gene ID 64802
mRNA Refseq NM_022787
Protein Refseq NP_073624
MIM 608700
UniProt ID Q9HAN9
Chromosome Location 1p36.22
Pathway Metabolism; Metabolism of vitamins and cofactors; Metabolism of water-soluble vitamins and cofactors
Function ATP binding; nicotinamide-nucleotide adenylyltransferase activity; nicotinamide-nucleotide adenylyltransferase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NMNAT1 Products

Required fields are marked with *

My Review for All NMNAT1 Products

Required fields are marked with *

0
cart-icon