Recombinant Human AKAP5, His-tagged

Cat.No. : AKAP5-23H
Product Overview : Recombinant Human A-Kinase Anchor Protein 5/AKAP5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Gln427) of Human AKAP5 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-427 a.a.
Description : A-Kinase Anchor Protein 5 (AKAP5) is a member of the AKAP family. AKAP5 contains one AKAP domain and is predominantly expressed in the cerebral cortex. AKAP5 may anchor the PKA protein to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors. AKAP5 association with to the β-2-adrenergic receptor (β2-AR) not only regulates β2-AR signaling pathway, but also the activation by PKA by switching off the β2-AR signaling cascade.
AA Sequence : METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVARKCPQE AGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKKAKSRLKIPCI KFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQDLSEGISRKDGDEVC ESNVSNSITSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQDVQPQQASPLETSETDHQQP VLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTEIVAEETKPKDTELSQESDFKENGITEE KSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYET LLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name AKAP5 A kinase (PRKA) anchor protein 5 [ Homo sapiens ]
Official Symbol AKAP5
Synonyms AKAP5; A kinase (PRKA) anchor protein 5; A-kinase anchor protein 5; AKAP75; AKAP79; AKAP-5; AKAP 79; A-kinase anchor protein 79 kDa; A-kinase anchor protein, 79kDa; A-kinase anchoring protein 75/79; cAMP-dependent protein kinase regulatory subunit II high affinity binding protein; cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein; H21;
Gene ID 9495
mRNA Refseq NM_004857
Protein Refseq NP_004848
MIM 604688
UniProt ID P24588
Chromosome Location 14q21-q24
Pathway Calcium signaling in the CD4+ TCR pathway, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; Glutamate Binding, Activation of AMPA Receptors and Synaptic Plasticity, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Neuronal System, organism-specific biosystem; Neurotransmitter Receptor Binding And Downstream Transmission In ThePostsynaptic Cell, organism-specific biosystem;
Function adenylate cyclase binding; calmodulin binding; protein binding; protein kinase A binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKAP5 Products

Required fields are marked with *

My Review for All AKAP5 Products

Required fields are marked with *

0
cart-icon
0
compare icon