Recombinant Human AKAP5, His-tagged
Cat.No. : | AKAP5-23H |
Product Overview : | Recombinant Human A-Kinase Anchor Protein 5/AKAP5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Gln427) of Human AKAP5 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-427 a.a. |
Description : | A-Kinase Anchor Protein 5 (AKAP5) is a member of the AKAP family. AKAP5 contains one AKAP domain and is predominantly expressed in the cerebral cortex. AKAP5 may anchor the PKA protein to cytoskeletal and/or organelle-associated proteins, targeting the signal carried by cAMP to specific intracellular effectors. AKAP5 association with to the β-2-adrenergic receptor (β2-AR) not only regulates β2-AR signaling pathway, but also the activation by PKA by switching off the β2-AR signaling cascade. |
AA Sequence : | METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVARKCPQE AGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKKAKSRLKIPCI KFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQDLSEGISRKDGDEVC ESNVSNSITSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQDVQPQQASPLETSETDHQQP VLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTEIVAEETKPKDTELSQESDFKENGITEE KSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYET LLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | AKAP5 A kinase (PRKA) anchor protein 5 [ Homo sapiens ] |
Official Symbol | AKAP5 |
Synonyms | AKAP5; A kinase (PRKA) anchor protein 5; A-kinase anchor protein 5; AKAP75; AKAP79; AKAP-5; AKAP 79; A-kinase anchor protein 79 kDa; A-kinase anchor protein, 79kDa; A-kinase anchoring protein 75/79; cAMP-dependent protein kinase regulatory subunit II high affinity binding protein; cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein; H21; |
Gene ID | 9495 |
mRNA Refseq | NM_004857 |
Protein Refseq | NP_004848 |
MIM | 604688 |
UniProt ID | P24588 |
Chromosome Location | 14q21-q24 |
Pathway | Calcium signaling in the CD4+ TCR pathway, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; Glutamate Binding, Activation of AMPA Receptors and Synaptic Plasticity, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Neuronal System, organism-specific biosystem; Neurotransmitter Receptor Binding And Downstream Transmission In ThePostsynaptic Cell, organism-specific biosystem; |
Function | adenylate cyclase binding; calmodulin binding; protein binding; protein kinase A binding; |
◆ Recombinant Proteins | ||
Akap5-3029R | Recombinant Rat Akap5, His-tagged | +Inquiry |
AKAP5-2451H | Recombinant Human AKAP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKAP5-1479M | Recombinant Mouse AKAP5 Protein | +Inquiry |
Akap5-110M | Recombinant Mouse Akap5 Protein, His&GST-tagged | +Inquiry |
AKAP5-23H | Recombinant Human AKAP5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP5-8939HCL | Recombinant Human AKAP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKAP5 Products
Required fields are marked with *
My Review for All AKAP5 Products
Required fields are marked with *