Recombinant Human ALG5, His-tagged

• Cat.No.: ALG5-25H
• Product Overview: Recombinant Human Asparagine-Linked Glycosylation Protein 5 Homolog/ALG5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Asp324) of Human ALG5 fused with a polyhistidine tag at the C-terminus.

Specification

• Description: Asparagine-Linked Glycosylation Protein 5 Homolog (ALG5) belongs to the glycosyltransferase 2 family. ALG5 is a single-pass type II membrane protein and is found in the Endoplasmic Reticulum membrane. It is also expressed in the pancreas, placenta, kidney, skeletal muscle, liver, heart, brain, and lung. ALG5 participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition.
• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: TTATKMPALHRHEEEKFFLNAKGQKETLPSIW DSPTKQLSVVVPSYNEEKRLPVMMDEALSYLE KRQKRDPAFTYEVIVVDDGSKDQTSKVA FKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRG EKILMADADGATKFPDVEKLEKGL NDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFH FLVWFLCVKGIRDTQCGFKL FTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTE IEGSKLVPFWSWLQMG KDLLFIRLRYLTGAWRLEQTRKMN
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: ALG5 asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ALG5
• Synonyms: ALG5; asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 5 homolog (yeast, dolichyl phosphate beta glucosyltransferase); dolichyl-phosphate beta-glucosyltransferase; bA421P11.2; dolP-glucosyltransferase; Alg5, S. cerevisiae, homolog of; dolichyl phosphate glucosyltransferase; asparagine-linked glycosylation protein 5 homolog; asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase); asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphate beta-glucosyltransferase); RP11-421P11.2
• Gene ID: 29880
• mRNA Refseq: NM_001142364
• Protein Refseq: NP_001135836
• MIM: 604565
• UniProt ID: Q9Y673
• Chromosome Location: 13q13.1
• Pathway: Asparagine N-linked glycosylation, organism-specific biosystem; Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem; Post-translational protein modification, organism-specific biosystem
• Function: dolichyl-phosphate beta-glucosyltransferase activity; oligosaccharyl transferase activity; transferase activity, transferring glycosyl groups