Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ALG5, His-tagged

Cat.No. : ALG5-25H
Product Overview : Recombinant Human Asparagine-Linked Glycosylation Protein 5 Homolog/ALG5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Asp324) of Human ALG5 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
Description : Asparagine-Linked Glycosylation Protein 5 Homolog (ALG5) belongs to the glycosyltransferase 2 family. ALG5 is a single-pass type II membrane protein and is found in the Endoplasmic Reticulum membrane. It is also expressed in the pancreas, placenta, kidney, skeletal muscle, liver, heart, brain, and lung. ALG5 participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition.
Source : HEK293
Species : Human
Tag : His
AA Sequence : TTATKMPALHRHEEEKFFLNAKGQKETLPSIW DSPTKQLSVVVPSYNEEKRLPVMMDEALSYLE KRQKRDPAFTYEVIVVDDGSKDQTSKVA FKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRG EKILMADADGATKFPDVEKLEKGL NDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFH FLVWFLCVKGIRDTQCGFKL FTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTE IEGSKLVPFWSWLQMG KDLLFIRLRYLTGAWRLEQTRKMN
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name : ALG5 asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol : ALG5
Synonyms : ALG5; asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 5 homolog (yeast, dolichyl phosphate beta glucosyltransferase); dolichyl-phosphate beta-glucosyltransferase; bA421P11.2; dolP-glucosyltransferase; Alg5, S. cerevisiae, homolog of; dolichyl phosphate glucosyltransferase; asparagine-linked glycosylation protein 5 homolog; asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase); asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphate beta-glucosyltransferase); RP11-421P11.2;
Gene ID : 29880
mRNA Refseq : NM_001142364
Protein Refseq : NP_001135836
MIM : 604565
UniProt ID : Q9Y673
Chromosome Location : 13q13.1
Pathway : Asparagine N-linked glycosylation, organism-specific biosystem; Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem; Post-translational protein modification, organism-specific biosystem;
Function : dolichyl-phosphate beta-glucosyltransferase activity; oligosaccharyl transferase activity; transferase activity, transferring glycosyl groups;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends