"CD300E" Related Products

Expand
Expand

Recombinant Human CD300E, His-tagged

Cat.No.: CD300E-58H
Product Overview: Recombinant Human CD300E is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Leu18-Leu169) of Human CD300E fused with a polyhistidine tag at the C-terminus.
Description: CD300E is a single-pass type I membrane protein that belongs to the CD300 family. CD300E has a single extracellular V-type Ig-like domain and presents on the surface of mature hematopoietic cells of the monocyte and myeloid lineages. CD300E acts as an activating receptor of the immunoglobulin (Ig) superfamily. It also mediates activating signals by interacting with DAP12.
Source: HEK293
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence: LKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHP EALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFL VVNPGRNLSTREVLTQNSGFRLVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: CD300E CD300e molecule [ Homo sapiens ]
Official Symbol: CD300E
Synonyms: CD300E; CD300e molecule; CD300 antigen like family member E , CD300e antigen , CD300LE; CMRF35-like molecule 2; CLM2; IREM2; CD300e antigen; poly-Ig receptor 2; CD300 antigen like family member E; CD300 antigen-like family member E; polymeric immunoglobulin receptor 2; immune receptor expressed on myeloid cells 2; CLM-2; PIgR2; IREM-2; PIgR-2; CD300LE; CMRF35-A5;
Gene ID: 342510
mRNA Refseq: NM_181449
Protein Refseq: NP_852114
MIM: 609801
UniProt ID: Q496F6
Chromosome Location: 17q25.1
Function: receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.