"CEACAM7" Related Products

Expand

Recombinant Human CEACAM7, His-tagged

Cat.No.: CEACAM7-63H
Product Overview: Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7/CEACAM7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr36-Phe142) of Human CEACAM7 fused with a polyhistidine tag at the C-terminus.
Description: Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7 (CEACAM7) is a member of the immunoglobulin superfamily A and CEA family. CEACAM7 localizes to the cell membrane and contains one Ig-like C2-type domain and one Ig-like V-type domain. The expression of CEACAM7 is significantly decreased in rectal cancer. Differences in CEACAM7 expression levels between long-term survivors and those with recurrent disease introduce a potential tumor marker to define a subset of patients who benefit most from adjuvant therapy.
Source: HEK293
Species: Human
Tag: His
AA Sequence: NIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRET IYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: CEACAM7 carcinoembryonic antigen-related cell adhesion molecule 7 [ Homo sapiens ]
Official Symbol: CEACAM7
Synonyms: CEACAM7; carcinoembryonic antigen-related cell adhesion molecule 7; CGM2; carcinoembryonic antigen gene family member 2; CEA; carcinoembryonic antigen CGM2;
Gene ID: 1087
mRNA Refseq: NM_006890
Protein Refseq: NP_008821
UniProt ID: Q14002
Chromosome Location: 19q13.2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.