Recombinant Human CEACAM7 Protein, His-SUMO-tagged
Cat.No. : | CEACAM7-1161H |
Product Overview : | Recombinant Human CEACAM7 Protein (36-242aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 36-242 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 39.4 kDa |
AA Sequence : | TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPN GTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNT TYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | CEACAM7 carcinoembryonic antigen-related cell adhesion molecule 7 [ Homo sapiens ] |
Official Symbol | CEACAM7 |
Synonyms | CEACAM7; carcinoembryonic antigen-related cell adhesion molecule 7; CGM2; carcinoembryonic antigen gene family member 2; CEA; carcinoembryonic antigen CGM2 |
Gene ID | 1087 |
mRNA Refseq | NM_006890 |
Protein Refseq | NP_008821 |
UniProt ID | Q14002 |
◆ Recombinant Proteins | ||
CEACAM7-1161H | Recombinant Human CEACAM7 Protein, His-SUMO-tagged | +Inquiry |
CEACAM7-572H | Recombinant Human CEACAM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CEACAM7-1006H | Recombinant Human CEACAM7 Protein (Thr36-Phe142), C-His tagged | +Inquiry |
CEACAM7-63H | Recombinant Human CEACAM7, His-tagged | +Inquiry |
CEACAM7-7614H | Recombinant Human CEACAM7, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM7-179HCL | Recombinant Human CEACAM7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEACAM7 Products
Required fields are marked with *
My Review for All CEACAM7 Products
Required fields are marked with *
0
Inquiry Basket