Recombinant Human CEACAM7 Protein, His-SUMO-tagged

Cat.No. : CEACAM7-1161H
Product Overview : Recombinant Human CEACAM7 Protein (36-242aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 36-242 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 39.4 kDa
AA Sequence : TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPN
GTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNT
TYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name CEACAM7 carcinoembryonic antigen-related cell adhesion molecule 7 [ Homo sapiens ]
Official Symbol CEACAM7
Synonyms CEACAM7; carcinoembryonic antigen-related cell adhesion molecule 7; CGM2; carcinoembryonic antigen gene family member 2; CEA; carcinoembryonic antigen CGM2
Gene ID 1087
mRNA Refseq NM_006890
Protein Refseq NP_008821
UniProt ID Q14002

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEACAM7 Products

Required fields are marked with *

My Review for All CEACAM7 Products

Required fields are marked with *

0
cart-icon