Recombinant Human CEACAM7 Protein, His-SUMO-tagged
| Cat.No. : | CEACAM7-1161H |
| Product Overview : | Recombinant Human CEACAM7 Protein (36-242aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 36-242 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 39.4 kDa |
| AA Sequence : | TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPN GTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNT TYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | CEACAM7 carcinoembryonic antigen-related cell adhesion molecule 7 [ Homo sapiens ] |
| Official Symbol | CEACAM7 |
| Synonyms | CEACAM7; carcinoembryonic antigen-related cell adhesion molecule 7; CGM2; carcinoembryonic antigen gene family member 2; CEA; carcinoembryonic antigen CGM2 |
| Gene ID | 1087 |
| mRNA Refseq | NM_006890 |
| Protein Refseq | NP_008821 |
| UniProt ID | Q14002 |
| ◆ Recombinant Proteins | ||
| CEACAM7-1161H | Recombinant Human CEACAM7 Protein, His-SUMO-tagged | +Inquiry |
| CEACAM7-572H | Recombinant Human CEACAM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CEACAM7-3195H | Recombinant Human CEACAM7 Protein, MYC/DDK-tagged | +Inquiry |
| CEACAM7-1835HFL | Recombinant Full Length Human CEACAM7 Protein, C-Flag-tagged | +Inquiry |
| CEACAM7-0848H | Recombinant Human CEACAM7 Protein (Lys147-Thr231), His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CEACAM7-179HCL | Recombinant Human CEACAM7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM7 Products
Required fields are marked with *
My Review for All CEACAM7 Products
Required fields are marked with *
