Species : |
Human |
Source : |
HEK293 |
Tag : |
His |
Protein Length : |
19-224 a.a. |
Description : |
Dickkopf-Related Protein 4 (DKK4) is a member of the DKK protein family that includes DKK1, DKK2, DKK3, and DKK4. DKK1 and DKK4 are Wnt antagonists. DKK1 and DKK4 antagonize Wnt/β-Catenin signaling by direct high affinity binding to the Wnt coreceptor LRP5/6 and inhibiting interaction of LRP5/6 with the Wnt Frizzled complex. DKK1 and DKK4 also bind the transmembrane proteins Kremen1 (Krm1) and Kremen 2 (Krm2) with high affinity. Krm2 has been shown to form a ternary complex with DKK1or DKK4 and LRP5/LRP6 to trigger internalization of the complex and removal of LRP6 from the cell surface. Thus, DKK1/DKK4 and Kremens function synergistically to antagonize LRP5/LRP6 mediated Wnt activity. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. |
Form : |
Lyophilized from a 0.2 μM filtered solution of 10mM Tris-Citrate, 150mM NaCl, pH 8.0 |
AA Sequence : |
LVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGT LCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRT FDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHA RLRVCQKIEKLVDHHHHHH |
Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : |
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |