"EMID1" Related Products

Recombinant Human EMID1, His-tagged

Cat.No.: EMID1-80H
Product Overview: Recombinant Human EMI Domain-Containing Protein 1/EMID1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Trp23-Gly443) of Human EMID1 fused with a 6His tag at the C-terminus.
Description: EMI Domain-Containing Protein 1 (EMID1) is a secreted protein. EMID1 contains one collagen-like domain and one EMI domain. Human EMID1 is synthesized as a 443 amino acid precursor that contains an 22 amino acid signal sequence and a 419 amino acid mature chain. EMID1 may be homo- or heteromers. Despite that EMU gene family suggest multiple functions during in embryogenesis, the exact function of EMID1 remains unknown.
Source: HEK293
Species: Human
Tag: His
AA Sequence: WSIGAAPFSGRRNWCSYVVTRTISCHVQNGTYLQRVLQNCPWPMSCPGSSYRTVVRPTYKVMYKI VTAREWRCCPGHSGVSCEEVAGSSASLEPMWSGSTMRRMALRPTAFSGCLNCSKVSELTERLKVL EAKMTMLTVIEQPVPPTPATPEDPAPLWGPPPAQGSPGDGGLQDQVGAWGLPGPTGPKGDAGSRG PMGMRGPPGPQGPPGSPGRAGAVGTPGERGPPGPPGPPGPPGPPAPVGPPHARISQHGDPLLSNT FTETNNHWPQGPTGPPGPPGPMGPPGPPGPTGVPGSPGHIGPPGPTGPKGISGHPGEKGERGLRG EPGPQGSAGQRGEPGPKGDPGEKSHWGEGLHQLREALKILAERVLILETMIGLYEPELGSGAGPA GTGTPSLLRGKRGGHATNYRIVAPRSRDERGVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: EMID1 EMI domain containing 1 [ Homo sapiens ]
Official Symbol: EMID1
Synonyms: EMID1; EMI domain containing 1; EMI domain-containing protein 1; EMI5; emilin and multimerin domain containing protein 1; EMU1; hEmu1; putative emu1; emilin and multimerin domain-containing protein 1; emilin and multimerin-domain containing protein 1; MGC50657;
Gene ID: 129080
mRNA Refseq: NM_133455
Protein Refseq: NP_597712
MIM: 608926
UniProt ID: Q96A84
Chromosome Location: 22q12.2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.