Recombinant Human EMID1, His-tagged

Cat.No. : EMID1-80H
Product Overview : Recombinant Human EMI Domain-Containing Protein 1/EMID1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Trp23-Gly443) of Human EMID1 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 23-443 a.a.
Description : EMI Domain-Containing Protein 1 (EMID1) is a secreted protein. EMID1 contains one collagen-like domain and one EMI domain. Human EMID1 is synthesized as a 443 amino acid precursor that contains an 22 amino acid signal sequence and a 419 amino acid mature chain. EMID1 may be homo- or heteromers. Despite that EMU gene family suggest multiple functions during in embryogenesis, the exact function of EMID1 remains unknown.
AA Sequence : WSIGAAPFSGRRNWCSYVVTRTISCHVQNGTYLQRVLQNCPWPMSCPGSSYRTVVRPTYKVMYKI VTAREWRCCPGHSGVSCEEVAGSSASLEPMWSGSTMRRMALRPTAFSGCLNCSKVSELTERLKVL EAKMTMLTVIEQPVPPTPATPEDPAPLWGPPPAQGSPGDGGLQDQVGAWGLPGPTGPKGDAGSRG PMGMRGPPGPQGPPGSPGRAGAVGTPGERGPPGPPGPPGPPGPPAPVGPPHARISQHGDPLLSNT FTETNNHWPQGPTGPPGPPGPMGPPGPPGPTGVPGSPGHIGPPGPTGPKGISGHPGEKGERGLRG EPGPQGSAGQRGEPGPKGDPGEKSHWGEGLHQLREALKILAERVLILETMIGLYEPELGSGAGPA GTGTPSLLRGKRGGHATNYRIVAPRSRDERGVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name EMID1 EMI domain containing 1 [ Homo sapiens ]
Official Symbol EMID1
Synonyms EMID1; EMI domain containing 1; EMI domain-containing protein 1; EMI5; emilin and multimerin domain containing protein 1; EMU1; hEmu1; putative emu1; emilin and multimerin domain-containing protein 1; emilin and multimerin-domain containing protein 1; MGC50657;
Gene ID 129080
mRNA Refseq NM_133455
Protein Refseq NP_597712
MIM 608926
UniProt ID Q96A84
Chromosome Location 22q12.2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EMID1 Products

Required fields are marked with *

My Review for All EMID1 Products

Required fields are marked with *

0
cart-icon