Recombinant Human EMID1, His-tagged
| Cat.No. : | EMID1-80H | 
| Product Overview : | Recombinant Human EMI Domain-Containing Protein 1/EMID1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Trp23-Gly443) of Human EMID1 fused with a 6His tag at the C-terminus. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | His | 
| Protein Length : | 23-443 a.a. | 
| Description : | EMI Domain-Containing Protein 1 (EMID1) is a secreted protein. EMID1 contains one collagen-like domain and one EMI domain. Human EMID1 is synthesized as a 443 amino acid precursor that contains an 22 amino acid signal sequence and a 419 amino acid mature chain. EMID1 may be homo- or heteromers. Despite that EMU gene family suggest multiple functions during in embryogenesis, the exact function of EMID1 remains unknown. | 
| AA Sequence : | WSIGAAPFSGRRNWCSYVVTRTISCHVQNGTYLQRVLQNCPWPMSCPGSSYRTVVRPTYKVMYKI VTAREWRCCPGHSGVSCEEVAGSSASLEPMWSGSTMRRMALRPTAFSGCLNCSKVSELTERLKVL EAKMTMLTVIEQPVPPTPATPEDPAPLWGPPPAQGSPGDGGLQDQVGAWGLPGPTGPKGDAGSRG PMGMRGPPGPQGPPGSPGRAGAVGTPGERGPPGPPGPPGPPGPPAPVGPPHARISQHGDPLLSNT FTETNNHWPQGPTGPPGPPGPMGPPGPPGPTGVPGSPGHIGPPGPTGPKGISGHPGEKGERGLRG EPGPQGSAGQRGEPGPKGDPGEKSHWGEGLHQLREALKILAERVLILETMIGLYEPELGSGAGPA GTGTPSLLRGKRGGHATNYRIVAPRSRDERGVDHHHHHH | 
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). | 
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. | 
| Gene Name | EMID1 EMI domain containing 1 [ Homo sapiens ] | 
| Official Symbol | EMID1 | 
| Synonyms | EMID1; EMI domain containing 1; EMI domain-containing protein 1; EMI5; emilin and multimerin domain containing protein 1; EMU1; hEmu1; putative emu1; emilin and multimerin domain-containing protein 1; emilin and multimerin-domain containing protein 1; MGC50657; | 
| Gene ID | 129080 | 
| mRNA Refseq | NM_133455 | 
| Protein Refseq | NP_597712 | 
| MIM | 608926 | 
| UniProt ID | Q96A84 | 
| Chromosome Location | 22q12.2 | 
| ◆ Recombinant Proteins | ||
| EMID1-80H | Recombinant Human EMID1, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| EMID1-6610HCL | Recombinant Human EMID1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All EMID1 Products
Required fields are marked with *
My Review for All EMID1 Products
Required fields are marked with *
  
        
    
      
            