Recombinant Human EMID1, His-tagged
Cat.No. : | EMID1-80H |
Product Overview : | Recombinant Human EMI Domain-Containing Protein 1/EMID1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Trp23-Gly443) of Human EMID1 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 23-443 a.a. |
Description : | EMI Domain-Containing Protein 1 (EMID1) is a secreted protein. EMID1 contains one collagen-like domain and one EMI domain. Human EMID1 is synthesized as a 443 amino acid precursor that contains an 22 amino acid signal sequence and a 419 amino acid mature chain. EMID1 may be homo- or heteromers. Despite that EMU gene family suggest multiple functions during in embryogenesis, the exact function of EMID1 remains unknown. |
AA Sequence : | WSIGAAPFSGRRNWCSYVVTRTISCHVQNGTYLQRVLQNCPWPMSCPGSSYRTVVRPTYKVMYKI VTAREWRCCPGHSGVSCEEVAGSSASLEPMWSGSTMRRMALRPTAFSGCLNCSKVSELTERLKVL EAKMTMLTVIEQPVPPTPATPEDPAPLWGPPPAQGSPGDGGLQDQVGAWGLPGPTGPKGDAGSRG PMGMRGPPGPQGPPGSPGRAGAVGTPGERGPPGPPGPPGPPGPPAPVGPPHARISQHGDPLLSNT FTETNNHWPQGPTGPPGPPGPMGPPGPPGPTGVPGSPGHIGPPGPTGPKGISGHPGEKGERGLRG EPGPQGSAGQRGEPGPKGDPGEKSHWGEGLHQLREALKILAERVLILETMIGLYEPELGSGAGPA GTGTPSLLRGKRGGHATNYRIVAPRSRDERGVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | EMID1 EMI domain containing 1 [ Homo sapiens ] |
Official Symbol | EMID1 |
Synonyms | EMID1; EMI domain containing 1; EMI domain-containing protein 1; EMI5; emilin and multimerin domain containing protein 1; EMU1; hEmu1; putative emu1; emilin and multimerin domain-containing protein 1; emilin and multimerin-domain containing protein 1; MGC50657; |
Gene ID | 129080 |
mRNA Refseq | NM_133455 |
Protein Refseq | NP_597712 |
MIM | 608926 |
UniProt ID | Q96A84 |
Chromosome Location | 22q12.2 |
◆ Recombinant Proteins | ||
EMID1-80H | Recombinant Human EMID1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMID1-6610HCL | Recombinant Human EMID1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMID1 Products
Required fields are marked with *
My Review for All EMID1 Products
Required fields are marked with *