"ERO1L" Related Products

Expand

Recombinant Human ERO1L, His-tagged

Cat.No.: ERO1L-82H
Product Overview: Recombinant Human ERO1-Like Protein α/ERO1L is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu24-His468) of Human ERO1L fused with a polyhistidine tag at the C-terminus.
Description: ERO1-Like Protein α (ERO1L) is an enzyme that belongs to the EROs family. ERO1L is expressed at high level in esophagus and upper digestive tract. ERO1L is an essential oxidoreductase that oxidizes proteins in the endoplasmic reticulum to produce disulfide bonds. ERO1L acts by oxidizing directly P4HB/PDI isomerase through a direct disulfide exchange. It associates with ERP44, demonstrating that it does not oxidize all PDI related proteins and can discriminate between PDI and related proteins. Its reoxidation probably involves electron transfer to molecular oxygen via FAD. ERO1L may be responsible for a significant proportion of reactive oxygen species (ROS) in the cell. ERO1L responses to temperature stimulus, protein thiol-disulfide exchange, protein folding with or without chaperone cofactor and transport.
Source: HEK293
Species: Human
Tag: His
AA Sequence: EEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFRYYKVNLKRPCPFW NDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVL QWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPL NPLASGQGTSEENTFYSWLEGLCVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITE FQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEIL HEIKSFPLHFDENSFFAGDKKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALK ILFSEKLIANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIHVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: ERO1L ERO1-like (S. cerevisiae) [ Homo sapiens ]
Official Symbol: ERO1L
Synonyms: ERO1L; ERO1-like (S. cerevisiae); ERO1 (S. cerevisiae) like; ERO1-like protein alpha; ERO1 alpha; ERO1A; ERO1-L; ERO1-L-alpha; oxidoreductin-1-L-alpha; endoplasmic oxidoreductin-1-like protein; ERO1-alpha;
Gene ID: 30001
mRNA Refseq: NM_014584
Protein Refseq: NP_055399
UniProt ID: Q96HE7
Chromosome Location: 14q22.1
Pathway: Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; Vibrio cholerae infection, organism-specific biosystem; Vibrio cholerae infection, conserved biosystem;
Function: flavin adenine dinucleotide binding; oxidoreductase activity; oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.