Recombinant Human ERO1L, His-tagged
Cat.No. : | ERO1L-82H |
Product Overview : | Recombinant Human ERO1-Like Protein α/ERO1L is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu24-His468) of Human ERO1L fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-468 a.a. |
Description : | ERO1-Like Protein α (ERO1L) is an enzyme that belongs to the EROs family. ERO1L is expressed at high level in esophagus and upper digestive tract. ERO1L is an essential oxidoreductase that oxidizes proteins in the endoplasmic reticulum to produce disulfide bonds. ERO1L acts by oxidizing directly P4HB/PDI isomerase through a direct disulfide exchange. It associates with ERP44, demonstrating that it does not oxidize all PDI related proteins and can discriminate between PDI and related proteins. Its reoxidation probably involves electron transfer to molecular oxygen via FAD. ERO1L may be responsible for a significant proportion of reactive oxygen species (ROS) in the cell. ERO1L responses to temperature stimulus, protein thiol-disulfide exchange, protein folding with or without chaperone cofactor and transport. |
AA Sequence : | EEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLESDYFRYYKVNLKRPCPFW NDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVL QWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPL NPLASGQGTSEENTFYSWLEGLCVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITE FQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEIL HEIKSFPLHFDENSFFAGDKKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALK ILFSEKLIANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIHVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | ERO1L ERO1-like (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ERO1L |
Synonyms | ERO1L; ERO1-like (S. cerevisiae); ERO1 (S. cerevisiae) like; ERO1-like protein alpha; ERO1 alpha; ERO1A; ERO1-L; ERO1-L-alpha; oxidoreductin-1-L-alpha; endoplasmic oxidoreductin-1-like protein; ERO1-alpha; |
Gene ID | 30001 |
mRNA Refseq | NM_014584 |
Protein Refseq | NP_055399 |
UniProt ID | Q96HE7 |
Chromosome Location | 14q22.1 |
Pathway | Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; Vibrio cholerae infection, organism-specific biosystem; Vibrio cholerae infection, conserved biosystem; |
Function | flavin adenine dinucleotide binding; oxidoreductase activity; oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor; |
◆ Recombinant Proteins | ||
ERO1L-10673Z | Recombinant Zebrafish ERO1L | +Inquiry |
ERO1L-4955C | Recombinant Chicken ERO1L | +Inquiry |
ERO1L-1800R | Recombinant Rat ERO1L Protein, His (Fc)-Avi-tagged | +Inquiry |
ERO1L-2143R | Recombinant Rat ERO1L Protein | +Inquiry |
ERO1L-82H | Recombinant Human ERO1L, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERO1L-6546HCL | Recombinant Human ERO1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERO1L Products
Required fields are marked with *
My Review for All ERO1L Products
Required fields are marked with *