Recombinant Human INSL4, His-tagged

Cat.No. : INSL4-118H
Product Overview : Recombinant Human Early Placenta Insulin-Like Peptide/INSL4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala26-Thr139) of Human INSL4 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 26-139 a.a.
Description : Early Placenta Insulin-Like Peptide (INSL4) belongs to the insulin family. INSL4 is expressed in the early placental cytotrophoblast and syncytiotrophoblast INSL4 is a secreted protein and a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. INSL4 plays an important role in the development of trophoblast and in the regulation of bone formation.
AA Sequence : AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLS PELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCTVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name INSL4 insulin-like 4 (placenta) [ Homo sapiens ]
Official Symbol INSL4
Synonyms INSL4; insulin-like 4 (placenta); early placenta insulin-like peptide; EPIL; insulin-like peptide 4; early placenta insulin-like peptide (EPIL); PLACENTIN;
Gene ID 3641
mRNA Refseq NM_002195
Protein Refseq NP_002186
MIM 600910
UniProt ID Q14641
Chromosome Location 9p24
Function hormone activity; insulin-like growth factor receptor binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INSL4 Products

Required fields are marked with *

My Review for All INSL4 Products

Required fields are marked with *

0
cart-icon