"INSL4" Related Products

Expand
Expand

Recombinant Human INSL4, His-tagged

Cat.No.: INSL4-118H
Product Overview: Recombinant Human Early Placenta Insulin-Like Peptide/INSL4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala26-Thr139) of Human INSL4 fused with a 6His tag at the C-terminus.
Description: Early Placenta Insulin-Like Peptide (INSL4) belongs to the insulin family. INSL4 is expressed in the early placental cytotrophoblast and syncytiotrophoblast INSL4 is a secreted protein and a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. INSL4 plays an important role in the development of trophoblast and in the regulation of bone formation.
Source: HEK293
Species: Human
Tag: His
AA Sequence: AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLS PELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCTVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: INSL4 insulin-like 4 (placenta) [ Homo sapiens ]
Official Symbol: INSL4
Synonyms: INSL4; insulin-like 4 (placenta); early placenta insulin-like peptide; EPIL; insulin-like peptide 4; early placenta insulin-like peptide (EPIL); PLACENTIN;
Gene ID: 3641
mRNA Refseq: NM_002195
Protein Refseq: NP_002186
MIM: 600910
UniProt ID: Q14641
Chromosome Location: 9p24
Function: hormone activity; insulin-like growth factor receptor binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.