Recombinant Human INSL4, His-tagged
Cat.No. : | INSL4-118H |
Product Overview : | Recombinant Human Early Placenta Insulin-Like Peptide/INSL4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala26-Thr139) of Human INSL4 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 26-139 a.a. |
Description : | Early Placenta Insulin-Like Peptide (INSL4) belongs to the insulin family. INSL4 is expressed in the early placental cytotrophoblast and syncytiotrophoblast INSL4 is a secreted protein and a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. INSL4 plays an important role in the development of trophoblast and in the regulation of bone formation. |
AA Sequence : | AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLS PELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCTVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | INSL4 insulin-like 4 (placenta) [ Homo sapiens ] |
Official Symbol | INSL4 |
Synonyms | INSL4; insulin-like 4 (placenta); early placenta insulin-like peptide; EPIL; insulin-like peptide 4; early placenta insulin-like peptide (EPIL); PLACENTIN; |
Gene ID | 3641 |
mRNA Refseq | NM_002195 |
Protein Refseq | NP_002186 |
MIM | 600910 |
UniProt ID | Q14641 |
Chromosome Location | 9p24 |
Function | hormone activity; insulin-like growth factor receptor binding; receptor binding; |
◆ Recombinant Proteins | ||
INSL4-5984HF | Recombinant Full Length Human INSL4 Protein, GST-tagged | +Inquiry |
INSL4-319H | Recombinant Human INSL4 protein(Met1-Thr139), His-tagged | +Inquiry |
INSL4-3117H | Recombinant Human INSL4 Protein (Ala26-Thr139), C-His tagged | +Inquiry |
INSL4-118H | Recombinant Human INSL4, His-tagged | +Inquiry |
INSL4-5096H | Recombinant Human INSL4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INSL4-001HCL | Recombinant Human INSL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSL4 Products
Required fields are marked with *
My Review for All INSL4 Products
Required fields are marked with *