"ITM2B" Related Products

Expand

Recombinant Human ITM2B, His-tagged

Cat.No.: ITM2B-120H
Product Overview: Recombinant Human Integral Membrane Protein 2B/ITM2B is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Tyr76-Ser266) of Human ITM2B fused with a polyhistidine tag at the C-terminus.
Description: Integral Membrane Protein 2B (ITM2B) is expressed in the Golgi and on the cell surface. ITM2B forms homodimer through disulfide-linked interaction with SPPL2A, SPPL2B and APP. ITM2B is expressed in brain and the other tissues. Defects in ITM2B cause cerebral amyloid angiopathy ITM2B-related type 1(CAA-ITM2B1) and amyloid angiopathy ITM2B-related type 2(CAA-ITM2B2). CAA-ITM2B1 is characterized by amyloid deposition in the walls of cerebral blood vessels and neurodegeneration in the central nervous system. CAA-ITM2B2 characterized by amyloid deposition in the walls of the blood vessels of the cerebrum, choroid plexus, cerebellum, spinal cord and retina.
Source: HEK293
Species: Human
Tag: His
AA Sequence: YKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADS DPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVI TDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICSVDHH HHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: ITM2B integral membrane protein 2B [ Homo sapiens ]
Official Symbol: ITM2B
Synonyms: ITM2B; integral membrane protein 2B; BRI; E3 16; E25B; ABri/ADan amyloid peptide; transmembrane protein BRI; BRICHOS domain containing 2B; FBD; ABRI; BRI2; E3-16; BRICD2B;
Gene ID: 9445
mRNA Refseq: NM_021999
Protein Refseq: NP_068839
MIM: 603904
UniProt ID: Q9Y287
Chromosome Location: 13q14.2
Pathway: Amyloids, organism-specific biosystem; Disease, organism-specific biosystem; IL-2 Signaling Pathway, organism-specific biosystem;
Function: ATP binding; beta-amyloid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.