| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
23-252 a.a. |
| Description : |
Neurexophilin-3 is a secreted protein that belongs to the Neurexophilin family. The 252 amino acid Neurexophilin-3 precursor contains a 22 amino acid signal peptide, a 230 amino acid proprecursor that is likely cleaved at a basic motif, producing a 76 amino acid propeptide and a 154 amino acid mature protein. Neurexophilin-3 is selectively expressed in subplate-derived neurons in the cortex, granule cells in the vestibulocerebellum, Cajal-Retzius cells during development, with the highest leves in brain. Neurexophilin-3 may act as a signaling molecule that resembles neuropeptides that act as a ligand for alpha-neurexins. |
| Form : |
Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| AA Sequence : |
QDDGPPGSEDPERDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPNRPN HSPPPSAKVKKIFGWGDFYSNIKTVALNLLVTGKIVDHGNGTFSVHFQHNATGQGNISISLVPPS KAVEFHQEQQIFIEAKASKIFNCRMGWEKVERGRRTSLCTHDPAKICSRDHAQSSATWSCSQPFK VVCVYIAFYSTDYRLVQKVCPDYNYHSDTPYYPSGVDHHHHHH |
| Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : |
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
| Reconstitution : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |