Recombinant Human NXPH3, His-tagged

Cat.No. : NXPH3-157H
Product Overview : Recombinant Human Neurexophilin-3 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Gln23-Gly252) of Human NXPH3 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 23-252 a.a.
Description : Neurexophilin-3 is a secreted protein that belongs to the Neurexophilin family. The 252 amino acid Neurexophilin-3 precursor contains a 22 amino acid signal peptide, a 230 amino acid proprecursor that is likely cleaved at a basic motif, producing a 76 amino acid propeptide and a 154 amino acid mature protein. Neurexophilin-3 is selectively expressed in subplate-derived neurons in the cortex, granule cells in the vestibulocerebellum, Cajal-Retzius cells during development, with the highest leves in brain. Neurexophilin-3 may act as a signaling molecule that resembles neuropeptides that act as a ligand for alpha-neurexins.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
AA Sequence : QDDGPPGSEDPERDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPNRPN HSPPPSAKVKKIFGWGDFYSNIKTVALNLLVTGKIVDHGNGTFSVHFQHNATGQGNISISLVPPS KAVEFHQEQQIFIEAKASKIFNCRMGWEKVERGRRTSLCTHDPAKICSRDHAQSSATWSCSQPFK VVCVYIAFYSTDYRLVQKVCPDYNYHSDTPYYPSGVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name NXPH3 neurexophilin 3 [ Homo sapiens ]
Official Symbol NXPH3
Synonyms NXPH3; neurexophilin 3; neurexophilin-3; NPH3;
Gene ID 11248
mRNA Refseq NM_007225
Protein Refseq NP_009156
MIM 604636
UniProt ID O95157
Chromosome Location 17q
Function molecular_function; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NXPH3 Products

Required fields are marked with *

My Review for All NXPH3 Products

Required fields are marked with *

0
cart-icon