Recombinant Human OBFC1, His-tagged

• Cat.No.: OBFC1-163H
• Product Overview: Recombinant Human Oligonucleotide/Oligosaccharide-Binding Fold-Containing Protein 1/OBFC1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Phe368) of Human OBFC1 fused with a His tag at the N-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-368 a.a.
• Description: CST Complex Subunit STN1 (OBFC1) is a 368 amino acid protein that contains one OB DNA-binding domain. It is a member of the STN1 family. OBFC1 is component of the CST complex, a complex that binds to single-stranded DNA and is required to protect telomeres from DNA degradation. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. In addition to telomere protection, the CST complex has probably a more general role in DNA metabolism at non-telomeric sites.
• Form: Supplied as a 0.2 μM filtered solution of 20mM Tris, 1mM DTT, pH 8.0
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPG VFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLT SQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATAYYKVDDPVWNIQIARMLELPTIYR KVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLAN QPVIHSACSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIH RIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: OBFC1 oligonucleotide/oligosaccharide-binding fold containing 1 [ Homo sapiens ]
• Official Symbol: OBFC1
• Synonyms: OBFC1; oligonucleotide/oligosaccharide-binding fold containing 1; CST complex subunit STN1; bA541N10.2; FLJ22559; alpha accessory factor 44; suppressor of cdc thirteen homolog; replication protein A 32 kDa subunit; oligonucleotide/oligosaccharide-binding fold-containing protein 1; STN1; AAF44; AAF-44; RPA-32; RP11-541N10.2
• Gene ID: 79991
• mRNA Refseq: NM_024928
• Protein Refseq: NP_079204
• MIM: 613128
• UniProt ID: Q9H668
• Chromosome Location: 10q25.1
• Function: DNA binding; protein binding; single-stranded DNA binding; single-stranded telomeric DNA binding