"OBFC1" Related Products

Expand

Recombinant Human OBFC1, His-tagged

Cat.No.: OBFC1-163H
Product Overview: Recombinant Human Oligonucleotide/Oligosaccharide-Binding Fold-Containing Protein 1/OBFC1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Phe368) of Human OBFC1 fused with a His tag at the N-terminus.
Description: CST Complex Subunit STN1 (OBFC1) is a 368 amino acid protein that contains one OB DNA-binding domain. It is a member of the STN1 family. OBFC1 is component of the CST complex, a complex that binds to single-stranded DNA and is required to protect telomeres from DNA degradation. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. In addition to telomere protection, the CST complex has probably a more general role in DNA metabolism at non-telomeric sites.
Source: E. coli
Species: Human
Tag: His
Form: Supplied as a 0.2 μM filtered solution of 20mM Tris, 1mM DTT, pH 8.0
AA Sequence: MGSSHHHHHHSSGLVPRGSHMQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPG VFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLT SQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATAYYKVDDPVWNIQIARMLELPTIYR KVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLAN QPVIHSACSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIH RIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at Please minimize freeze-thaw cycles.
Gene Name: OBFC1 oligonucleotide/oligosaccharide-binding fold containing 1 [ Homo sapiens ]
Official Symbol: OBFC1
Synonyms: OBFC1; oligonucleotide/oligosaccharide-binding fold containing 1; CST complex subunit STN1; bA541N10.2; FLJ22559; alpha accessory factor 44; suppressor of cdc thirteen homolog; replication protein A 32 kDa subunit; oligonucleotide/oligosaccharide-binding fold-containing protein 1; STN1; AAF44; AAF-44; RPA-32; RP11-541N10.2;
Gene ID: 79991
mRNA Refseq: NM_024928
Protein Refseq: NP_079204
MIM: 613128
UniProt ID: Q9H668
Chromosome Location: 10q25.1
Function: DNA binding; protein binding; single-stranded DNA binding; single-stranded telomeric DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.