Recombinant Human OBFC1, His-tagged
Cat.No. : | OBFC1-163H |
Product Overview : | Recombinant Human Oligonucleotide/Oligosaccharide-Binding Fold-Containing Protein 1/OBFC1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Phe368) of Human OBFC1 fused with a His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-368 a.a. |
Description : | CST Complex Subunit STN1 (OBFC1) is a 368 amino acid protein that contains one OB DNA-binding domain. It is a member of the STN1 family. OBFC1 is component of the CST complex, a complex that binds to single-stranded DNA and is required to protect telomeres from DNA degradation. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. In addition to telomere protection, the CST complex has probably a more general role in DNA metabolism at non-telomeric sites. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris, 1mM DTT, pH 8.0 |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPG VFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLT SQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATAYYKVDDPVWNIQIARMLELPTIYR KVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLAN QPVIHSACSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIH RIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | OBFC1 oligonucleotide/oligosaccharide-binding fold containing 1 [ Homo sapiens ] |
Official Symbol | OBFC1 |
Synonyms | OBFC1; oligonucleotide/oligosaccharide-binding fold containing 1; CST complex subunit STN1; bA541N10.2; FLJ22559; alpha accessory factor 44; suppressor of cdc thirteen homolog; replication protein A 32 kDa subunit; oligonucleotide/oligosaccharide-binding fold-containing protein 1; STN1; AAF44; AAF-44; RPA-32; RP11-541N10.2; |
Gene ID | 79991 |
mRNA Refseq | NM_024928 |
Protein Refseq | NP_079204 |
MIM | 613128 |
UniProt ID | Q9H668 |
Chromosome Location | 10q25.1 |
Function | DNA binding; protein binding; single-stranded DNA binding; single-stranded telomeric DNA binding; |
◆ Recombinant Proteins | ||
OBFC1-163H | Recombinant Human OBFC1, His-tagged | +Inquiry |
OBFC1-11050M | Recombinant Mouse OBFC1 Protein | +Inquiry |
OBFC1-10704Z | Recombinant Zebrafish OBFC1 | +Inquiry |
OBFC1-508C | Recombinant Cynomolgus Monkey OBFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OBFC1-3150R | Recombinant Rhesus monkey OBFC1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OBFC1-3611HCL | Recombinant Human OBFC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OBFC1 Products
Required fields are marked with *
My Review for All OBFC1 Products
Required fields are marked with *