Recombinant Human OBFC1, His-tagged

Cat.No. : OBFC1-163H
Product Overview : Recombinant Human Oligonucleotide/Oligosaccharide-Binding Fold-Containing Protein 1/OBFC1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Phe368) of Human OBFC1 fused with a His tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-368 a.a.
Description : CST Complex Subunit STN1 (OBFC1) is a 368 amino acid protein that contains one OB DNA-binding domain. It is a member of the STN1 family. OBFC1 is component of the CST complex, a complex that binds to single-stranded DNA and is required to protect telomeres from DNA degradation. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. In addition to telomere protection, the CST complex has probably a more general role in DNA metabolism at non-telomeric sites.
Form : Supplied as a 0.2 μM filtered solution of 20mM Tris, 1mM DTT, pH 8.0
AA Sequence : MGSSHHHHHHSSGLVPRGSHMQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPG VFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLT SQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATAYYKVDDPVWNIQIARMLELPTIYR KVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLAN QPVIHSACSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIH RIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name OBFC1 oligonucleotide/oligosaccharide-binding fold containing 1 [ Homo sapiens ]
Official Symbol OBFC1
Synonyms OBFC1; oligonucleotide/oligosaccharide-binding fold containing 1; CST complex subunit STN1; bA541N10.2; FLJ22559; alpha accessory factor 44; suppressor of cdc thirteen homolog; replication protein A 32 kDa subunit; oligonucleotide/oligosaccharide-binding fold-containing protein 1; STN1; AAF44; AAF-44; RPA-32; RP11-541N10.2;
Gene ID 79991
mRNA Refseq NM_024928
Protein Refseq NP_079204
MIM 613128
UniProt ID Q9H668
Chromosome Location 10q25.1
Function DNA binding; protein binding; single-stranded DNA binding; single-stranded telomeric DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OBFC1 Products

Required fields are marked with *

My Review for All OBFC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon