| Cat.No.: | SLITRK3-191H |
| Product Overview: | Recombinant Human SLIT and NTRK-Like Protein 3/SLITRK3 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Thr29-Ser654) of Human SLITRK3 fused with a polyhistidine tag at the C-terminus. |
| Description: | SLIT and NTRK-Like Protein 3 (SLITRK3) is a member of the SLITRK family that are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. SLITRK3 contains an N-terminal signal peptide, followed by two LRR domains, a transmembrane domain, and a cytoplasmic domain with a putative tyrosine phosphorylation site. Each LRR domain is flanked by cysteine-rich regions. SLITRK3 is expressed at higher levels in some astrocytic brain tumors such as strocytomas, oligodendrogliomas, glioblastomas, gangliogliomas and primitive neuroectodermal tumors. |
| Source: | HEK293 |
| Species: | Human |
| Tag: | His |
| Form: | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| AA Sequence: | TPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLY TNSFLHLNNAVSINLGNNALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADY NVIKRIESGAFRNLSKLRVLILNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHIGRS LMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSE VEASLGIPHSSSSKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQPRTPRPPSTSQALYP GPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSN LIQKIYRSDFWNFSSLDLLHLGNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLH YLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVL EHLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHRDVRTIELEVLCPE MLHVAPAGESPAQPGDSHLIGAPTSASPYEFSPPGGPVPLSVDHHHHHH |
| Endotoxin: | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity: | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage: | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
| Reconstitution: | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name: | SLITRK3 SLIT and NTRK-like family, member 3 [ Homo sapiens ] |
| Official Symbol: | SLITRK3 |
| Synonyms: | SLITRK3; SLIT and NTRK-like family, member 3; SLIT and NTRK-like protein 3; KIAA0848; slit and trk like gene 3; MGC138681; |
| Gene ID: | 22865 |
| mRNA Refseq: | NM_014926 |
| Protein Refseq: | NP_055741 |
| MIM: | 609679 |
| UniProt ID: | O94933 |
| Chromosome Location: | 3q26.1 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All SLITRK3 Products
Download Datasheet