Recombinant Human SLITRK3, His-tagged

Cat.No. : SLITRK3-191H
Product Overview : Recombinant Human SLIT and NTRK-Like Protein 3/SLITRK3 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Thr29-Ser654) of Human SLITRK3 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 29-654 a.a.
Description : SLIT and NTRK-Like Protein 3 (SLITRK3) is a member of the SLITRK family that are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. SLITRK3 contains an N-terminal signal peptide, followed by two LRR domains, a transmembrane domain, and a cytoplasmic domain with a putative tyrosine phosphorylation site. Each LRR domain is flanked by cysteine-rich regions. SLITRK3 is expressed at higher levels in some astrocytic brain tumors such as strocytomas, oligodendrogliomas, glioblastomas, gangliogliomas and primitive neuroectodermal tumors.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
AA Sequence : TPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLY TNSFLHLNNAVSINLGNNALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADY NVIKRIESGAFRNLSKLRVLILNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHIGRS LMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSE VEASLGIPHSSSSKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQPRTPRPPSTSQALYP GPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSN LIQKIYRSDFWNFSSLDLLHLGNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLH YLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVL EHLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHRDVRTIELEVLCPE MLHVAPAGESPAQPGDSHLIGAPTSASPYEFSPPGGPVPLSVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name SLITRK3 SLIT and NTRK-like family, member 3 [ Homo sapiens ]
Official Symbol SLITRK3
Synonyms SLITRK3; SLIT and NTRK-like family, member 3; SLIT and NTRK-like protein 3; KIAA0848; slit and trk like gene 3; MGC138681;
Gene ID 22865
mRNA Refseq NM_014926
Protein Refseq NP_055741
MIM 609679
UniProt ID O94933
Chromosome Location 3q26.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLITRK3 Products

Required fields are marked with *

My Review for All SLITRK3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon