| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
29-654 a.a. |
| Description : |
SLIT and NTRK-Like Protein 3 (SLITRK3) is a member of the SLITRK family that are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. SLITRK3 contains an N-terminal signal peptide, followed by two LRR domains, a transmembrane domain, and a cytoplasmic domain with a putative tyrosine phosphorylation site. Each LRR domain is flanked by cysteine-rich regions. SLITRK3 is expressed at higher levels in some astrocytic brain tumors such as strocytomas, oligodendrogliomas, glioblastomas, gangliogliomas and primitive neuroectodermal tumors. |
| Form : |
Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| AA Sequence : |
TPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLY TNSFLHLNNAVSINLGNNALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADY NVIKRIESGAFRNLSKLRVLILNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHIGRS LMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSE VEASLGIPHSSSSKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQPRTPRPPSTSQALYP GPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSN LIQKIYRSDFWNFSSLDLLHLGNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLH YLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVL EHLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHRDVRTIELEVLCPE MLHVAPAGESPAQPGDSHLIGAPTSASPYEFSPPGGPVPLSVDHHHHHH |
| Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : |
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
| Reconstitution : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
