"FN1" Related Products

Recombinant Human Fibronectin III 8-10, 13, GST-tagged

Cat.No.: FN1-107H
Product Overview: This recombinant FN fragment corresponds to amino acids 1235-1509 of type-III 8-10, joined to 1782-1870 of type-III 13 by an ID linker This fragment contains the complete itegrin binding region of the peptide, required for cell binding and adhesion, as well as the C-terminal heprin binding domain region.
Description: Fibronectins (FN) are a family of high molecular weight, multidomain glycoproteins composed of two structurally similar subunits which are joined at the carboxyl terminus by disulfide bonds. The primary structure of FN is organized into three types of repeating homologous units, termed types I, II, and III. These modules in turn are organized into functional domains which have been shown to contain multiple binding sites, including those for sulfated glycosaminoglycans, gelatin, fibrin, and cell surface integrin receptors. Twelve type I modules are found grouped at the amino- and carboxyl-terminal regions, and two type II modules are located within the gelatin-binding region. Fifteen to seventeen type III modules are contained within the middle of the molecule and comprise 60% of fibronectin’s sequence.
Source: E. coli
Species: Human
Tag: GST
Molecular Mass: 66364.3 Da
AA Sequence: AVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSS VYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITL TNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSP VQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT*ID*NVSPPRRARVTDATETTITIS WRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDAST
Purity: > 90% by SDS-PAGE
Storage: Store at -80°C
Concentration: 4.0 mg/ml
Storage Buffer: Solution in PBS
Shipping: Dry Ice
Gene Name: FN1 fibronectin 1 [ Homo sapiens ]
Official Symbol: FN1
Synonyms: FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149;
Gene ID: 2335
mRNA Refseq: NM_002026
Protein Refseq: NP_002017
MIM: 135600
UniProt ID: P02751
Chromosome Location: 2q34
Pathway: Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem;
Function: collagen binding; extracellular matrix structural constituent; heparin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.