Recombinant Human FN1 protein, T7/His-tagged
| Cat.No. : | FN1-35H |
| Product Overview : | Recombinant fourteenth FN-III domain of Human fibronectin cDNA fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.5 mg/ml, sterile-filtered, in PBS. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFNVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQAPIQ RTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDAST |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro human ES lineage specific differentiation regulations study coating with this protein.2. May be used for in vitro protein-protein interaction mapping.3. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 15 days. |
| Gene Name | FN1 fibronectin 1 [ Homo sapiens ] |
| Official Symbol | FN1 |
| Synonyms | FN1; fibronectin 1; fibronectin; CIG; cold insoluble globulin; FINC; GFND2; LETS; migration stimulating factor; MSF; cold-insoluble globulin; migration-stimulating factor; FN; FNZ; ED-B; GFND; DKFZp686H0342; DKFZp686I1370; DKFZp686F10164; DKFZp686O13149; |
| Gene ID | 2335 |
| mRNA Refseq | NM_002026 |
| Protein Refseq | NP_002017 |
| MIM | 135600 |
| UniProt ID | P02751 |
| Chromosome Location | 2q34 |
| Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; |
| Function | collagen binding; extracellular matrix structural constituent; heparin binding; protein binding; |
| ◆ Recombinant Proteins | ||
| Fn1-760M | Recombinant Mouse Fn1 protein, His-tagged | +Inquiry |
| FN1-420H | Recombinant Human FN1 Protein | +Inquiry |
| FN1-41H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
| FN1-4143H | Recombinant Human FN1 Protein (Pro1270-Ser1546, Ala1721-Thr2016) | +Inquiry |
| FN1-96H | Recombinant Human FN1 protein | +Inquiry |
| ◆ Native Proteins | ||
| FN1-700H | Native Human Fibronectin 1 | +Inquiry |
| FN1-701H | Native Human Fibronectin 1 | +Inquiry |
| FN1-2708HB | Native Human Fibronectin Protein, Biotinylated | +Inquiry |
| FN1-4399H | Native Human FN1 Protein | +Inquiry |
| Fn1-5424M | Native Mouse Fibronectin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FN1-166HKCL | Human FN1 Knockdown Cell Lysate | +Inquiry |
| FN1-2956HCL | Recombinant Human FN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FN1 Products
Required fields are marked with *
My Review for All FN1 Products
Required fields are marked with *
