Recombinant Human MUSK, GST-tagged

Cat.No. : MUSK-105H
Product Overview : Human MUSK partial ORF ( NP_005583, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described.
Molecular Mass : 36.63 kDa
AA Sequence : ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLC NHIFQECSPGVVPTPIPICREYCLA
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MUSK muscle, skeletal, receptor tyrosine kinase [ Homo sapiens (human) ]
Official Symbol MUSK
Synonyms MUSK; muscle, skeletal, receptor tyrosine kinase; muscle, skeletal receptor tyrosine-protein kinase; muscle-specific kinase receptor; muscle-specific tyrosine-protein kinase receptor; EC 2.7.10.1
Gene ID 4593
mRNA Refseq NM_005592
Protein Refseq NP_005583
MIM 601296
UniProt ID O15146
Chromosome Location 9q31.3-q32
Pathway ECM proteoglycans; Extracellular matrix organization
Function ATP binding; protein binding; protein tyrosine kinase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUSK Products

Required fields are marked with *

My Review for All MUSK Products

Required fields are marked with *

0
cart-icon
0
compare icon