Recombinant Human MUSK, GST-tagged
| Cat.No. : | MUSK-105H | 
| Product Overview : | Human MUSK partial ORF ( NP_005583, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described. | 
| Molecular Mass : | 36.63 kDa | 
| AA Sequence : | ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLC NHIFQECSPGVVPTPIPICREYCLA | 
| Applications : | ELISA; WB-Re; AP; Array | 
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | MUSK muscle, skeletal, receptor tyrosine kinase [ Homo sapiens (human) ] | 
| Official Symbol | MUSK | 
| Synonyms | MUSK; muscle, skeletal, receptor tyrosine kinase; muscle, skeletal receptor tyrosine-protein kinase; muscle-specific kinase receptor; muscle-specific tyrosine-protein kinase receptor; EC 2.7.10.1 | 
| Gene ID | 4593 | 
| mRNA Refseq | NM_005592 | 
| Protein Refseq | NP_005583 | 
| MIM | 601296 | 
| UniProt ID | O15146 | 
| Chromosome Location | 9q31.3-q32 | 
| Pathway | ECM proteoglycans; Extracellular matrix organization | 
| Function | ATP binding; protein binding; protein tyrosine kinase activity | 
| ◆ Recombinant Proteins | ||
| MUSK-30261TH | Recombinant Human MUSK | +Inquiry | 
| MUSK-959H | Recombinant Human MUSK protein(Arg433-Val783), His&GST-tagged | +Inquiry | 
| MUSK-105H | Recombinant Human MUSK, GST-tagged | +Inquiry | 
| MUSK-47H | Recombinant Human MUSK Protein, His-tagged | +Inquiry | 
| Musk-45M | Recombinant Mouse Musk Protein, mIgG2a tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUSK Products
Required fields are marked with *
My Review for All MUSK Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            