Recombinant Human MUSK, GST-tagged
Cat.No. : | MUSK-105H |
Product Overview : | Human MUSK partial ORF ( NP_005583, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLC NHIFQECSPGVVPTPIPICREYCLA |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MUSK muscle, skeletal, receptor tyrosine kinase [ Homo sapiens (human) ] |
Official Symbol | MUSK |
Synonyms | MUSK; muscle, skeletal, receptor tyrosine kinase; muscle, skeletal receptor tyrosine-protein kinase; muscle-specific kinase receptor; muscle-specific tyrosine-protein kinase receptor; EC 2.7.10.1 |
Gene ID | 4593 |
mRNA Refseq | NM_005592 |
Protein Refseq | NP_005583 |
MIM | 601296 |
UniProt ID | O15146 |
Chromosome Location | 9q31.3-q32 |
Pathway | ECM proteoglycans; Extracellular matrix organization |
Function | ATP binding; protein binding; protein tyrosine kinase activity |
◆ Recombinant Proteins | ||
Musk-45M | Recombinant Mouse Musk Protein, mIgG2a tagged | +Inquiry |
MUSK-3825R | Recombinant Rat MUSK Protein | +Inquiry |
MUSK-1434H | Active Recombinant Human MUSK, GST-tagged | +Inquiry |
MUSK-5760H | Active Recombinant Human MUSK Protein, GST/His-tagged | +Inquiry |
Musk-42M | Recombinant Mouse Musk Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUSK Products
Required fields are marked with *
My Review for All MUSK Products
Required fields are marked with *