"MUSK" Related Products

Expand
Expand

Recombinant Human MUSK, GST-tagged

Cat.No.: MUSK-105H
Product Overview: Human MUSK partial ORF ( NP_005583, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.63 kDa
AA Sequence: ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLC NHIFQECSPGVVPTPIPICREYCLA
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MUSK muscle, skeletal, receptor tyrosine kinase [ Homo sapiens (human) ]
Official Symbol: MUSK
Synonyms: MUSK; muscle, skeletal, receptor tyrosine kinase; muscle, skeletal receptor tyrosine-protein kinase; muscle-specific kinase receptor; muscle-specific tyrosine-protein kinase receptor; EC 2.7.10.1
Gene ID: 4593
mRNA Refseq: NM_005592
Protein Refseq: NP_005583
MIM: 601296
UniProt ID: O15146
Chromosome Location: 9q31.3-q32
Pathway: ECM proteoglycans; Extracellular matrix organization
Function: ATP binding; protein binding; protein tyrosine kinase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.