Recombinant Human NME2 protein, His-tagged
Cat.No. : | NME2-1311H |
Product Overview : | Recombinant Human NME2 protein(1-152 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-152 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | NME2 non-metastatic cells 2, protein (NM23B) expressed in [ Homo sapiens ] |
Official Symbol | NME2 |
Synonyms | NME2; non-metastatic cells 2, protein (NM23B) expressed in; nucleoside diphosphate kinase B; NM23 H2; NDP kinase B; c-myc transcription factor; histidine protein kinase NDKB; nucleotide diphosphate kinase B; c-myc purine-binding transcription factor PUF; non-metastatic cells 2, protein (NM23) expressed in; PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2; MGC2212; MGC111212; |
mRNA Refseq | NM_001018137 |
Protein Refseq | NP_001018147 |
MIM | 156491 |
UniProt ID | P22392 |
Gene ID | 4831 |
◆ Recombinant Proteins | ||
NME2-10739M | Recombinant Mouse NME2 Protein | +Inquiry |
NME2-193H | Active Recombinant Human NME2 protein | +Inquiry |
NME2-6572HF | Recombinant Full Length Human NME2 Protein, GST-tagged | +Inquiry |
NME2-1946H | Recombinant Human NME2 | +Inquiry |
NME2-6604C | Recombinant Chicken NME2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME2-3791HCL | Recombinant Human NME2 293 Cell Lysate | +Inquiry |
NME2-3790HCL | Recombinant Human NME2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME2 Products
Required fields are marked with *
My Review for All NME2 Products
Required fields are marked with *