Recombinant Human NME2 protein, GST-tagged

Cat.No. : NME2-30171H
Product Overview : Recombinant Human NME2 protein(1-152 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 1-152 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name NME2 non-metastatic cells 2, protein (NM23B) expressed in [ Homo sapiens ]
Official Symbol NME2
Synonyms NME2; non-metastatic cells 2, protein (NM23B) expressed in; nucleoside diphosphate kinase B; NM23 H2; NDP kinase B; c-myc transcription factor; histidine protein kinase NDKB; nucleotide diphosphate kinase B; c-myc purine-binding transcription factor PUF; non-metastatic cells 2, protein (NM23) expressed in; PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2; MGC2212; MGC111212;
mRNA Refseq NM_001018137
Protein Refseq NP_001018147
MIM 156491
UniProt ID P22392
Gene ID 4831

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NME2 Products

Required fields are marked with *

My Review for All NME2 Products

Required fields are marked with *

0
cart-icon
0
compare icon