Recombinant Human PPP2CA protein, His-tagged

Cat.No. : PPP2CA-1913H
Product Overview : Recombinant Human PPP2CA protein(1-309 aa), fused with His tag, was expressed in E.coli.
Availability July 14, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-309 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Publications :
CDC25B partners with PP2A to induce AMPK activation and tumor suppression in triple negative breast cancer (2020)
Gene Name PPP2CA protein phosphatase 2, catalytic subunit, alpha isozyme [ Homo sapiens ]
Official Symbol PPP2CA
Synonyms PPP2CA; protein phosphatase 2, catalytic subunit, alpha isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform; serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; PP2Calpha; protein phosphatase 2A catalytic subunit; alpha isoform; PP2A-alpha; replication protein C; protein phosphatase 2A catalytic subunit, alpha isoform; serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform; RP-C; PP2Ac; PP2CA;
Gene ID 5515
mRNA Refseq NM_002715
Protein Refseq NP_002706
MIM 176915
UniProt ID P67775

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP2CA Products

Required fields are marked with *

My Review for All PPP2CA Products

Required fields are marked with *

0
cart-icon