Recombinant Human PPP2CA protein, His-tagged
Cat.No. : | PPP2CA-1913H |
Product Overview : | Recombinant Human PPP2CA protein(1-309 aa), fused with His tag, was expressed in E.coli. |
Availability | July 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-309 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Publications : |
CDC25B partners with PP2A to induce AMPK activation and tumor suppression in triple negative breast cancer (2020)
|
Gene Name | PPP2CA protein phosphatase 2, catalytic subunit, alpha isozyme [ Homo sapiens ] |
Official Symbol | PPP2CA |
Synonyms | PPP2CA; protein phosphatase 2, catalytic subunit, alpha isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform; serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; PP2Calpha; protein phosphatase 2A catalytic subunit; alpha isoform; PP2A-alpha; replication protein C; protein phosphatase 2A catalytic subunit, alpha isoform; serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform; RP-C; PP2Ac; PP2CA; |
Gene ID | 5515 |
mRNA Refseq | NM_002715 |
Protein Refseq | NP_002706 |
MIM | 176915 |
UniProt ID | P67775 |
◆ Recombinant Proteins | ||
PPP2CA-077H | Recombinant Human PPP2CA Protein, octahistidine/streptactin-tagged | +Inquiry |
PPP2CA-1913H | Recombinant Human PPP2CA protein, His-tagged | +Inquiry |
PPP2CA-577HFL | Recombinant Full Length Human PPP2CA Protein, C-Flag-tagged | +Inquiry |
PPP2CA-6786H | Recombinant Human PPP2CA protein, His&Myc-tagged | +Inquiry |
PPP2CA-5319H | Recombinant Human PPP2CA protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2CA-2929HCL | Recombinant Human PPP2CA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP2CA Products
Required fields are marked with *
My Review for All PPP2CA Products
Required fields are marked with *