"NCOA3" Related Products

Expand

Recombinant Human NCOA3, GST-tagged

Cat.No.: NCOA3-121H
Product Overview: Recombinant Human NCOA3(251 a.a. - 360 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Several transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 37.84 kDa
AA Sequence: RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLN GHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: NCOA3 nuclear receptor coactivator 3 [ Homo sapiens (human) ]
Official Symbol: NCOA3
Synonyms: NCOA3; ACTR; AIB1; RAC3; SRC3; pCIP; AIB-1; CTG26; SRC-3; CAGH16; KAT13B; TNRC14; TNRC16; TRAM-1; bHLHe42; nuclear receptor coactivator 3; nuclear receptor coactivator 3; CBP-interacting protein; receptor-associated coactivator 3; amplified in breast cancer 1 protein; steroid receptor coactivator protein 3; class E basic helix-loop-helix protein 42; thyroid hormone receptor activator molecule 1; NP_001167558.1; EC 2.3.1.48; NP_001167559.1; NP_006525.2; NP_858045.1
Gene ID: 8202
mRNA Refseq: NM_006534
Protein Refseq: NP_006525
MIM: 601937
UniProt ID: Q9Y6Q9
Chromosome Location: 20q12
Pathway: Androgen receptor signaling pathway; FOXA1 transcription factor network; Fatty acid, triacylglycerol, and ketone body metabolism
Function: androgen receptor binding; histone acetyltransferase activity; ligand-dependent nuclear receptor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.