Recombinant Human NCOA3, GST-tagged
Cat.No. : | NCOA3-121H |
Product Overview : | Recombinant Human NCOA3(251 a.a. - 360 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Several transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLN GHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NCOA3 nuclear receptor coactivator 3 [ Homo sapiens (human) ] |
Official Symbol | NCOA3 |
Synonyms | NCOA3; ACTR; AIB1; RAC3; SRC3; pCIP; AIB-1; CTG26; SRC-3; CAGH16; KAT13B; TNRC14; TNRC16; TRAM-1; bHLHe42; nuclear receptor coactivator 3; nuclear receptor coactivator 3; CBP-interacting protein; receptor-associated coactivator 3; amplified in breast cancer 1 protein; steroid receptor coactivator protein 3; class E basic helix-loop-helix protein 42; thyroid hormone receptor activator molecule 1; NP_001167558.1; EC 2.3.1.48; NP_001167559.1; NP_006525.2; NP_858045.1 |
Gene ID | 8202 |
mRNA Refseq | NM_006534 |
Protein Refseq | NP_006525 |
MIM | 601937 |
UniProt ID | Q9Y6Q9 |
Chromosome Location | 20q12 |
Pathway | Androgen receptor signaling pathway; FOXA1 transcription factor network; Fatty acid, triacylglycerol, and ketone body metabolism |
Function | androgen receptor binding; histone acetyltransferase activity; ligand-dependent nuclear receptor binding |
◆ Recombinant Proteins | ||
Ncoa3-1350R | Recombinant Rat Ncoa3 protein, His & T7-tagged | +Inquiry |
NCOA3-5199H | Recombinant Human NCOA3 Protein (Gly1023-Ala1304), N-His tagged | +Inquiry |
NCOA3-7035H | Recombinant Human RAC3, His-tagged | +Inquiry |
NCOA3-121H | Recombinant Human NCOA3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCOA3-3941HCL | Recombinant Human NCOA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCOA3 Products
Required fields are marked with *
My Review for All NCOA3 Products
Required fields are marked with *