"GTF3C4" Related Products

Recombinant Human GTF3C4, GST-tagged

Cat.No.: GTF3C4-120H
Product Overview: Recombinant Human GTF3C4(723 a.a. - 822 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: General transcription factor 3C polypeptide 4 is a protein that in humans is encoded by the GTF3C4 gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.74 kDa
AA Sequence: DDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIARH PAPEDPDWIKRLLQSPCPFCDSPVF
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: GTF3C4 general transcription factor IIIC, polypeptide 4, 90kDa [ Homo sapiens (human) ]
Official Symbol: GTF3C4
Synonyms: GTF3C4; KAT12; TFIII90; TFIIIC90; TFIIIC290; TFIIICDELTA; general transcription factor IIIC, polypeptide 4, 90kDa; general transcription factor 3C polypeptide 4; TF3C-delta; TFIIIC 90 kDa subunit; general transcription factor 3C 4; transcription factor IIIC subunit delta; transcription factor IIIC 90 kDa subunit; NP_036336.2; EC 2.3.1.48
Gene ID: 9329
mRNA Refseq: NM_012204
Protein Refseq: NP_036336
MIM: 604892
UniProt ID: Q9UKN8
Chromosome Location: 9q34.13
Pathway: RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription; RNA Polymerase III Abortive And Retractive Initiation; RNA Polymerase III Transcription Initiation
Function: contributes_to DNA binding; enzyme activator activity; histone acetyltransferase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.