Recombinant Human GTF3C4, GST-tagged
Cat.No. : | GTF3C4-120H |
Product Overview : | Recombinant Human GTF3C4(723 a.a. - 822 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | General transcription factor 3C polypeptide 4 is a protein that in humans is encoded by the GTF3C4 gene. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIARH PAPEDPDWIKRLLQSPCPFCDSPVF |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GTF3C4 general transcription factor IIIC, polypeptide 4, 90kDa [ Homo sapiens (human) ] |
Official Symbol | GTF3C4 |
Synonyms | GTF3C4; KAT12; TFIII90; TFIIIC90; TFIIIC290; TFIIICDELTA; general transcription factor IIIC, polypeptide 4, 90kDa; general transcription factor 3C polypeptide 4; TF3C-delta; TFIIIC 90 kDa subunit; general transcription factor 3C 4; transcription factor IIIC subunit delta; transcription factor IIIC 90 kDa subunit; NP_036336.2; EC 2.3.1.48 |
Gene ID | 9329 |
mRNA Refseq | NM_012204 |
Protein Refseq | NP_036336 |
MIM | 604892 |
UniProt ID | Q9UKN8 |
Chromosome Location | 9q34.13 |
Pathway | RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription; RNA Polymerase III Abortive And Retractive Initiation; RNA Polymerase III Transcription Initiation |
Function | contributes_to DNA binding; enzyme activator activity; histone acetyltransferase activity |
◆ Recombinant Proteins | ||
GTF3C4-2013R | Recombinant Rhesus monkey GTF3C4 Protein, His-tagged | +Inquiry |
GTF3C4-120H | Recombinant Human GTF3C4, GST-tagged | +Inquiry |
GTF3C4-13603H | Recombinant Human GTF3C4, His-tagged | +Inquiry |
GTF3C4-1834R | Recombinant Rhesus Macaque GTF3C4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF3C4 Products
Required fields are marked with *
My Review for All GTF3C4 Products
Required fields are marked with *