Recombinant Human GTF3C4, GST-tagged GTF3C4-120H

Recombinant Human GTF3C4, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human GTF3C4, GST-tagged

Recombinant Human GTF3C4, GST-tagged

GTF3C4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GTF3C4-120H
Product Overview : Recombinant Human GTF3C4(723 a.a. - 822 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : General transcription factor 3C polypeptide 4 is a protein that in humans is encoded by the GTF3C4 gene.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 36.74 kDa
AA Sequence : DDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIARH PAPEDPDWIKRLLQSPCPFCDSPVF
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : GTF3C4 general transcription factor IIIC, polypeptide 4, 90kDa [ Homo sapiens (human) ]
Official Symbol : GTF3C4
Synonyms : GTF3C4; KAT12; TFIII90; TFIIIC90; TFIIIC290; TFIIICDELTA; general transcription factor IIIC, polypeptide 4, 90kDa; general transcription factor 3C polypeptide 4; TF3C-delta; TFIIIC 90 kDa subunit; general transcription factor 3C 4; transcription factor IIIC subunit delta; transcription factor IIIC 90 kDa subunit; NP_036336.2; EC 2.3.1.48
Gene ID : 9329
mRNA Refseq : NM_012204
Protein Refseq : NP_036336
MIM : 604892
UniProt ID : Q9UKN8
Chromosome Location : 9q34.13
Pathway : RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription; RNA Polymerase III Abortive And Retractive Initiation; RNA Polymerase III Transcription Initiation
Function : contributes_to DNA binding; enzyme activator activity; histone acetyltransferase activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy