Recombinant Human GTF3C4, GST-tagged

Cat.No. : GTF3C4-120H
Product Overview : Recombinant Human GTF3C4(723 a.a. - 822 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : General transcription factor 3C polypeptide 4 is a protein that in humans is encoded by the GTF3C4 gene.
Molecular Mass : 36.74 kDa
AA Sequence : DDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIARH PAPEDPDWIKRLLQSPCPFCDSPVF
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTF3C4 general transcription factor IIIC, polypeptide 4, 90kDa [ Homo sapiens (human) ]
Official Symbol GTF3C4
Synonyms GTF3C4; KAT12; TFIII90; TFIIIC90; TFIIIC290; TFIIICDELTA; general transcription factor IIIC, polypeptide 4, 90kDa; general transcription factor 3C polypeptide 4; TF3C-delta; TFIIIC 90 kDa subunit; general transcription factor 3C 4; transcription factor IIIC subunit delta; transcription factor IIIC 90 kDa subunit; NP_036336.2; EC 2.3.1.48
Gene ID 9329
mRNA Refseq NM_012204
Protein Refseq NP_036336
MIM 604892
UniProt ID Q9UKN8
Chromosome Location 9q34.13
Pathway RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription; RNA Polymerase III Abortive And Retractive Initiation; RNA Polymerase III Transcription Initiation
Function contributes_to DNA binding; enzyme activator activity; histone acetyltransferase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTF3C4 Products

Required fields are marked with *

My Review for All GTF3C4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon