Recombinant Human SOCS2 protein, His-tagged

Cat.No. : SOCS2-2871H
Product Overview : Recombinant Human SOCS2 protein(1-198 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability December 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-198 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol SOCS2
Synonyms SOCS2; suppressor of cytokine signaling 2; CIS2; Cish2; SOCS 2; SSI 2; SSI2; STAT induced STAT inhibitor 2; STATI2; CIS-2; STAT induced STAT inhibitor-2; STAT-induced STAT inhibitor 2; STAT-induced STAT inhibitor-2; cytokine-inducible SH2 protein 2; suppressor of cytokine signaling-2; SSI-2; SOCS-2;
Gene ID 8835
mRNA Refseq NM_003877
Protein Refseq NP_003868
MIM 605117
UniProt ID O14508

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOCS2 Products

Required fields are marked with *

My Review for All SOCS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon