Recombinant Human TAF9 protein, GST-tagged
Cat.No. : | TAF9-3108H |
Product Overview : | Recombinant Human TAF9 protein(1-172 aa), fused with GST tag, was expressed in E.coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-172 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa [ Homo sapiens ] |
Official Symbol | TAF9 |
Synonyms | TAF9; TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa; TAF2G, TATA box binding protein (TBP) associated factor, RNA polymerase II, G, 32kD; adenylate kinase isoenzyme 6; AD 004; adenylate kinase 6; AK6; CGI 137; CINAP; coilin interacting protein; MGC1603; MGC3647; MGC5067; TAFII31; TAFII32; TAFIID32; TAFII-31; TAFII-32; STAF31/32; ATP-AMP transphosphorylase 6; adrenal gland protein AD-004; coilin-interacting nuclear ATPase protein; transcription initiation factor TFIID subunit 9; RNA polymerase II TBP-associated factor subunit G; transcription initiation factor TFIID 31 kD subunit; transcription initiation factor TFIID 31 kDa subunit; transcription initiation factor TFIID 32 kDa subunit; CIP; TAF2G; AD-004; hCINAP; CGI-137; MGC:1603; MGC:3647; MGC:5067; |
Gene ID | 6880 |
mRNA Refseq | NM_001015891 |
Protein Refseq | NP_001015891 |
MIM | 600822 |
UniProt ID | Q16594 |
◆ Recombinant Proteins | ||
TAF9-3891Z | Recombinant Zebrafish TAF9 | +Inquiry |
TAF9-3417H | Recombinant Human TAF9, His-tagged | +Inquiry |
TAF9-16404M | Recombinant Mouse TAF9 Protein | +Inquiry |
TAF9-3108H | Recombinant Human TAF9 protein, GST-tagged | +Inquiry |
TAF9-4611R | Recombinant Rhesus monkey TAF9 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAF9-1265HCL | Recombinant Human TAF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAF9 Products
Required fields are marked with *
My Review for All TAF9 Products
Required fields are marked with *