Recombinant Human TAF9 protein, GST-tagged

Cat.No. : TAF9-3108H
Product Overview : Recombinant Human TAF9 protein(1-172 aa), fused with GST tag, was expressed in E.coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-172 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TAF9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa [ Homo sapiens ]
Official Symbol TAF9
Synonyms TAF9; TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa; TAF2G, TATA box binding protein (TBP) associated factor, RNA polymerase II, G, 32kD; adenylate kinase isoenzyme 6; AD 004; adenylate kinase 6; AK6; CGI 137; CINAP; coilin interacting protein; MGC1603; MGC3647; MGC5067; TAFII31; TAFII32; TAFIID32; TAFII-31; TAFII-32; STAF31/32; ATP-AMP transphosphorylase 6; adrenal gland protein AD-004; coilin-interacting nuclear ATPase protein; transcription initiation factor TFIID subunit 9; RNA polymerase II TBP-associated factor subunit G; transcription initiation factor TFIID 31 kD subunit; transcription initiation factor TFIID 31 kDa subunit; transcription initiation factor TFIID 32 kDa subunit; CIP; TAF2G; AD-004; hCINAP; CGI-137; MGC:1603; MGC:3647; MGC:5067;
Gene ID 6880
mRNA Refseq NM_001015891
Protein Refseq NP_001015891
MIM 600822
UniProt ID Q16594

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAF9 Products

Required fields are marked with *

My Review for All TAF9 Products

Required fields are marked with *

0
cart-icon
0
compare icon