Recombinant Human TIMM8A protein, GST-tagged

Cat.No. : TIMM8A-3239H
Product Overview : Recombinant Human TIMM8A protein(1-97 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability September 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-97 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name TIMM8A translocase of inner mitochondrial membrane 8 homolog A (yeast) [ Homo sapiens ]
Official Symbol TIMM8A
Synonyms TIMM8A; translocase of inner mitochondrial membrane 8 homolog A (yeast); DFN1, translocase of inner mitochondrial membrane 8 (yeast) homolog A; mitochondrial import inner membrane translocase subunit Tim8 A; DDP; MTS; deafness/dystonia peptide; deafness dystonia protein 1; X-linked deafness dystonia protein; DDP1; DFN1; TIM8; MGC12262;
Gene ID 1678
mRNA Refseq NM_001145951
Protein Refseq NP_001139423
MIM 300356
UniProt ID O60220

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TIMM8A Products

Required fields are marked with *

My Review for All TIMM8A Products

Required fields are marked with *

0
cart-icon
0
compare icon