Recombinant Human TIMM8A protein, GST-tagged
Cat.No. : | TIMM8A-3239H |
Product Overview : | Recombinant Human TIMM8A protein(1-97 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-97 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TIMM8A translocase of inner mitochondrial membrane 8 homolog A (yeast) [ Homo sapiens ] |
Official Symbol | TIMM8A |
Synonyms | TIMM8A; translocase of inner mitochondrial membrane 8 homolog A (yeast); DFN1, translocase of inner mitochondrial membrane 8 (yeast) homolog A; mitochondrial import inner membrane translocase subunit Tim8 A; DDP; MTS; deafness/dystonia peptide; deafness dystonia protein 1; X-linked deafness dystonia protein; DDP1; DFN1; TIM8; MGC12262; |
Gene ID | 1678 |
mRNA Refseq | NM_001145951 |
Protein Refseq | NP_001139423 |
MIM | 300356 |
UniProt ID | O60220 |
◆ Recombinant Proteins | ||
TIMM8A-2486H | Recombinant human TIMM8A, His-tagged | +Inquiry |
TIMM8A-4720R | Recombinant Rhesus monkey TIMM8A Protein, His-tagged | +Inquiry |
TIMM8A-5603C | Recombinant Chicken TIMM8A | +Inquiry |
TIMM8A-4534R | Recombinant Rhesus Macaque TIMM8A Protein, His (Fc)-Avi-tagged | +Inquiry |
TIMM8A-1059Z | Recombinant Zebrafish TIMM8A | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMM8A-1065HCL | Recombinant Human TIMM8A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIMM8A Products
Required fields are marked with *
My Review for All TIMM8A Products
Required fields are marked with *
0
Inquiry Basket