Recombinant Human TIMM8A protein, GST-tagged

• Cat.No.: TIMM8A-3239H
• Product Overview: Recombinant Human TIMM8A protein(1-97 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-97 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: TIMM8A translocase of inner mitochondrial membrane 8 homolog A (yeast) [ Homo sapiens ]
• Official Symbol: TIMM8A
• Synonyms: TIMM8A; translocase of inner mitochondrial membrane 8 homolog A (yeast); DFN1, translocase of inner mitochondrial membrane 8 (yeast) homolog A; mitochondrial import inner membrane translocase subunit Tim8 A; DDP; MTS; deafness/dystonia peptide; deafness dystonia protein 1; X-linked deafness dystonia protein; DDP1; DFN1; TIM8; MGC12262
• Gene ID: 1678
• mRNA Refseq: NM_001145951
• Protein Refseq: NP_001139423
• MIM: 300356
• UniProt ID: O60220