"GPIHBP1" Related Products

Expand
Expand

Recombinant Human GPIHBP1, GST-tagged

Cat.No.: GPIHBP1-1432H
Product Overview: Recombinant Human GPIHBP1(1 a.a. - 184 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Dietary fats are packaged by intestine into triglyceride-rich lipoproteins called chylomicrons. The triglycerides in chylomicrons are hydrolyzed by lipoprotein lipase (LPL: MIM 609708) along the luminal surface of capillaries, mainly in heart, skeletal muscle, and adipose tissue. GPIHBP1 is a capillary endothelial cell protein that provides a platform for LPL-mediated processing of chylomicrons.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 46.2 kDa
AA Sequence: MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDE RCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT GKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: GPIHBP1 glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 [ Homo sapiens (human) ]
Official Symbol: GPIHBP1
Synonyms: GPIHBP1; GPI-HBP1; glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1; glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-anchored HDL-binding protein 1; high density lipoprotein-binding protein 1; GPI anchored high density lipoprotein binding protein 1
Gene ID: 338328
mRNA Refseq: NM_178172
Protein Refseq: NP_835466
MIM: 612757
UniProt ID: Q8IV16
Chromosome Location: 8q24.3
Function: chylomicron binding; high-density lipoprotein particle binding; lipase binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.