Recombinant Human GPIHBP1, GST-tagged

Cat.No. : GPIHBP1-1432H
Product Overview : Recombinant Human GPIHBP1(1 a.a. - 184 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Dietary fats are packaged by intestine into triglyceride-rich lipoproteins called chylomicrons. The triglycerides in chylomicrons are hydrolyzed by lipoprotein lipase (LPL: MIM 609708) along the luminal surface of capillaries, mainly in heart, skeletal muscle, and adipose tissue. GPIHBP1 is a capillary endothelial cell protein that provides a platform for LPL-mediated processing of chylomicrons.
Molecular Mass : 46.2 kDa
AA Sequence : MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDE RCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT GKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPIHBP1 glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 [ Homo sapiens (human) ]
Official Symbol GPIHBP1
Synonyms GPIHBP1; GPI-HBP1; glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1; glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-anchored HDL-binding protein 1; high density lipoprotein-binding protein 1; GPI anchored high density lipoprotein binding protein 1
Gene ID 338328
mRNA Refseq NM_178172
Protein Refseq NP_835466
MIM 612757
UniProt ID Q8IV16
Chromosome Location 8q24.3
Function chylomicron binding; high-density lipoprotein particle binding; lipase binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPIHBP1 Products

Required fields are marked with *

My Review for All GPIHBP1 Products

Required fields are marked with *

0
cart-icon