Recombinant Human GPIHBP1, GST-tagged GPIHBP1-1432H

Recombinant Human GPIHBP1, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human GPIHBP1, GST-tagged

Recombinant Human GPIHBP1, GST-tagged

GPIHBP1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GPIHBP1-1432H
Product Overview : Recombinant Human GPIHBP1(1 a.a. - 184 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : Dietary fats are packaged by intestine into triglyceride-rich lipoproteins called chylomicrons. The triglycerides in chylomicrons are hydrolyzed by lipoprotein lipase (LPL: MIM 609708) along the luminal surface of capillaries, mainly in heart, skeletal muscle, and adipose tissue. GPIHBP1 is a capillary endothelial cell protein that provides a platform for LPL-mediated processing of chylomicrons.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 46.2 kDa
AA Sequence : MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDE RCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT GKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : GPIHBP1 glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 [ Homo sapiens (human) ]
Official Symbol : GPIHBP1
Synonyms : GPIHBP1; GPI-HBP1; glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1; glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-anchored HDL-binding protein 1; high density lipoprotein-binding protein 1; GPI anchored high density lipoprotein binding protein 1
Gene ID : 338328
mRNA Refseq : NM_178172
Protein Refseq : NP_835466
MIM : 612757
UniProt ID : Q8IV16
Chromosome Location : 8q24.3
Function : chylomicron binding; high-density lipoprotein particle binding; lipase binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy