Recombinant Full Length Human Glycosylphosphatidylinositol-Anchored High Density Lipoprotein-Binding Protein 1(Gpihbp1) Protein, His-Tagged
Cat.No. : | RFL28252HF |
Product Overview : | Recombinant Full Length Human Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1(GPIHBP1) Protein (Q8IV16) (21-184aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (21-184) |
Form : | Lyophilized powder |
AA Sequence : | QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLT QNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPP WQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPIHBP1 |
Synonyms | GPIHBP1; HBP1; Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-HBP1; GPI-anchored HDL-binding protein 1; High density lipoprotein-binding protein 1 |
UniProt ID | Q8IV16 |
◆ Recombinant Proteins | ||
GPIHBP1-13425H | Recombinant Human GPIHBP1, GST-tagged | +Inquiry |
GPIHBP1-6942HF | Recombinant Full Length Human GPIHBP1 Protein, GST-tagged | +Inquiry |
GPIHBP1-1935R | Recombinant Rhesus monkey GPIHBP1 Protein, His-tagged | +Inquiry |
GPIHBP1-7113M | Recombinant Mouse GPIHBP1 Protein | +Inquiry |
GPIHBP1-1755R | Recombinant Rhesus Macaque GPIHBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPIHBP1-5805HCL | Recombinant Human GPIHBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPIHBP1 Products
Required fields are marked with *
My Review for All GPIHBP1 Products
Required fields are marked with *