Recombinant Human EIF3F Protein, His-tagged
| Cat.No. : | EIF3F-274H |
| Product Overview : | Recombinant human EIF3F protein (380aa), fused to His-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Ubiquitous expression in ovary (RPKM 140.6), lymph node (RPKM 83.6) and 25 other tissues. |
| Form : | Liquid |
| Molecular Mass : | 40 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL |
| Purity : | > 90% by SDS-PAGE |
| Applications : | SDS-PAGE, Denatured |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1 mg/mL (determined by Bradford assay) |
| Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M urea |
| Gene Name | EIF3F eukaryotic translation initiation factor 3 subunit F [ Homo sapiens (human) ] |
| Official Symbol | EIF3F |
| Synonyms | EIF3F; eukaryotic translation initiation factor 3 subunit F; MRT67; EIF3S5; eIF3-p47; eukaryotic translation initiation factor 3 subunit F; deubiquitinating enzyme eIF3f; eIF-3-epsilon; eIF3-epsilon; eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD); eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; EC 3.4.19.12 |
| Gene ID | 8665 |
| mRNA Refseq | NM_003754 |
| Protein Refseq | NP_003745 |
| MIM | 603914 |
| UniProt ID | O00303 |
| ◆ Recombinant Proteins | ||
| EIF3F-231C | Recombinant Cynomolgus Monkey EIF3F Protein, His (Fc)-Avi-tagged | +Inquiry |
| EIF3F-0309H | Recombinant Human EIF3F Protein (A2-L357), Tag Free | +Inquiry |
| EIF3F-274H | Recombinant Human EIF3F Protein, His-tagged | +Inquiry |
| EIF3F-7900Z | Recombinant Zebrafish EIF3F | +Inquiry |
| EIF3F-4248HF | Recombinant Full Length Human EIF3F Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF3F-6661HCL | Recombinant Human EIF3F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3F Products
Required fields are marked with *
My Review for All EIF3F Products
Required fields are marked with *
