Recombinant Full Length Human EIF3F Protein, GST-tagged
| Cat.No. : | EIF3F-4248HF |
| Product Overview : | Human EIF3S5 full-length ORF ( AAH00490, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 357 amino acids |
| Description : | EIF3F (Eukaryotic Translation Initiation Factor 3 Subunit F) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S. GO annotations related to this gene include thiol-dependent ubiquitin-specific protease activity and translation initiation factor binding. An important paralog of this gene is PSMD7. |
| Molecular Mass : | 64.9 kDa |
| AA Sequence : | MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EIF3F eukaryotic translation initiation factor 3, subunit F [ Homo sapiens ] |
| Official Symbol | EIF3F |
| Synonyms | EIF3F; eukaryotic translation initiation factor 3, subunit F; EIF3S5, eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; eukaryotic translation initiation factor 3 subunit F; eIF3 epsilon; eIF3 p47; eIF3f; eIF3-epsilon; eIF-3-epsilon; eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD); EIF3S5; eIF3-p47; |
| Gene ID | 8665 |
| mRNA Refseq | NM_003754 |
| Protein Refseq | NP_003745 |
| MIM | 603914 |
| UniProt ID | O00303 |
| ◆ Recombinant Proteins | ||
| EIF3F-4248HF | Recombinant Full Length Human EIF3F Protein, GST-tagged | +Inquiry |
| EIF3F-3246H | Recombinant Human EIF3F protein, His-tagged | +Inquiry |
| EIF3F-2049HFL | Recombinant Full Length Human EIF3F Protein, C-Flag-tagged | +Inquiry |
| EIF3F-3181H | Recombinant Human EIF3F Protein, GST-tagged | +Inquiry |
| EIF3F-274H | Recombinant Human EIF3F Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF3F-6661HCL | Recombinant Human EIF3F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3F Products
Required fields are marked with *
My Review for All EIF3F Products
Required fields are marked with *
