Recombinant Full Length Human EIF3F Protein, GST-tagged

• Cat.No.: EIF3F-4248HF
• Product Overview: Human EIF3S5 full-length ORF ( AAH00490, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 357 amino acids
• Description: EIF3F (Eukaryotic Translation Initiation Factor 3 Subunit F) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S. GO annotations related to this gene include thiol-dependent ubiquitin-specific protease activity and translation initiation factor binding. An important paralog of this gene is PSMD7.
• Molecular Mass: 64.9 kDa
• AA Sequence: MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF3F eukaryotic translation initiation factor 3, subunit F [ Homo sapiens ]
• Official Symbol: EIF3F
• Synonyms: EIF3F; eukaryotic translation initiation factor 3, subunit F; EIF3S5, eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; eukaryotic translation initiation factor 3 subunit F; eIF3 epsilon; eIF3 p47; eIF3f; eIF3-epsilon; eIF-3-epsilon; eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD); EIF3S5; eIF3-p47
• Gene ID: 8665
• mRNA Refseq: NM_003754
• Protein Refseq: NP_003745
• MIM: 603914
• UniProt ID: O00303