"EXOC7" Related Products

Expand
Expand
Expand

Recombinant Human EXOC7, GST-tagged

Cat.No.: EXOC7-283H
Product Overview: Recombinant Human EXOC7(586 a.a. - 684 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.63 kDa
AA Sequence: VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKN PEKYIKYGVEQVGDMIDRLFDTSA
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: EXOC7 exocyst complex component 7 [ Homo sapiens (human) ]
Official Symbol: EXOC7
Synonyms: EXOC7; exocyst complex component 7; EXO70; Exo70p; KIAA1067; YJL085W; exocyst complex component Exo70
Gene ID: 23265
mRNA Refseq: NM_001013839
Protein Refseq: NP_001013861
MIM: 608163
UniProt ID: Q9UPT5
Chromosome Location: 17q25.1
Pathway: Arf6 trafficking events; Insulin Pathway; Insulin signaling pathway
Function: protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.