Active Recombinant Human PAK4

Cat.No. : PAK4-18H
Product Overview : PAK4KD is a recombinant wild type human PAK4 kinase domain (amino acids 300–591 of full-length human PAK4) expressed in E. coli and purified to homogeneity with full activity.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Human PAK4 kinase (UniProt: O96013; NCBI: NM_005884) belongs to a family of p21-activated kinases. These serine/threonine kinases are regulated by the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton.
Form : 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Bio-activity : 5,595 pmoles/min/μg
Molecular Mass : The calculated mass is 33,309. PAK4KD is fully phosphorylated at S474 with a measured mass of 33,389 (1P).
AA Sequence : GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIM RDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSD SILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNE PPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
Applications : Enzymatic studies, inhibitor screen, and selectivity profiling
Storage : Stable at -70oC for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70oC.
Gene Name PAK4 p21 protein (Cdc42/Rac)-activated kinase 4 [ Homo sapiens ]
Official Symbol PAK4
Synonyms PAK4; p21 protein (Cdc42/Rac)-activated kinase 4; p21(CDKN1A) activated kinase 4; serine/threonine-protein kinase PAK 4; PAK-4; p21-activated kinase 4; p21(CDKN1A)-activated kinase 4; protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs;
Gene ID 10298
mRNA Refseq NM_001014831
Protein Refseq NP_001014831
MIM 605451
UniProt ID O96013
Chromosome Location 19p11-q11
Pathway Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem;
Function ATP binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAK4 Products

Required fields are marked with *

My Review for All PAK4 Products

Required fields are marked with *

0
cart-icon
0
compare icon