"PAK4" Related Products

Recombinant Human PAK4

Cat.No. : PAK4-18H
Product Overview : PAK4KD is a recombinant wild type human PAK4 kinase domain (amino acids 300–591 of full-length human PAK4) expressed in E. coli and purified to homogeneity with full activity.
Description : Human PAK4 kinase (UniProt: O96013; NCBI: NM_005884) belongs to a family of p21-activated kinases. These serine/threonine kinases are regulated by the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton.
Source : E. coli
Species : Human
Form : 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Bio-activity : 5,595 pmoles/min/μg
Molecular Mass : The calculated mass is 33,309. PAK4KD is fully phosphorylated at S474 with a measured mass of 33,389 (1P).
AA Sequence : GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIM RDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSD SILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNE PPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
Applications : Enzymatic studies, inhibitor screen, and selectivity profiling
Storage : Stable at -70oC for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70oC.
Gene Name : PAK4 p21 protein (Cdc42/Rac)-activated kinase 4 [ Homo sapiens ]
Official Symbol : PAK4
Synonyms : PAK4; p21 protein (Cdc42/Rac)-activated kinase 4; p21(CDKN1A) activated kinase 4; serine/threonine-protein kinase PAK 4; PAK-4; p21-activated kinase 4; p21(CDKN1A)-activated kinase 4; protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs;
Gene ID : 10298
mRNA Refseq : NM_001014831
Protein Refseq : NP_001014831
MIM : 605451
UniProt ID : O96013
Chromosome Location : 19p11-q11
Pathway : Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem;
Function : ATP binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.