"mOrange" Related Products

By Species
    By Source
    By Tag

    Purified fluorescent protein mOrange

     Download Datasheet      See All mOrange Products
    Bring this labeled protein directly to your bench!
    Cat.No. : mOrange-22
    Product Overview : Purified fluorescent protein mOrange, with N-terminal HIS tag, expressed in E. coli, 250ug
    Source : E. coli
    Tag : His
    Molecular Mass : 26.7 kDa
    AA Sequence : MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGFQTAKLKVTKGGPLPFAWDILSPQFTYGSK AYVKHPADIPDYFKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA SSERMYPEDGALKGEIKMRLKLKDGGHYTSEVKTTYKAKKPVQLPGAYIVGIKLDITSHNEDYTIVEQYERAEGR HSTGGMDELYK
    Purity : >80% as determined by SDS-PAGE and Coomassie blue staining
    Concentration : >50 ug/mL as determined by microplate BCA method
    Storage Buffer : PBS, pH7.4, 10% glycerol.
       Download Datasheet

    Online Inquiry

    Note: There will be extra charge for optional service!

    Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

    Optional requirements on this protein    +Expand

    Price Inquiry

    Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.