Recombinant Human MT1G, GST-tagged

• Cat.No.: MT1G-126H
• Product Overview: Recombinant Human MT1G(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Metallothionein-1G is a protein that in humans is encoded by the MT1G gene.
• Molecular Mass: 32.5 kDa
• AA Sequence: MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MT1G metallothionein 1G [ Homo sapiens (human) ]
• Official Symbol: MT1G
• Synonyms: MT1G; MT1; MT1K; metallothionein 1G; metallothionein-1G; MT-1G; MT-1K; MT-IG; metallothionein 1K; metallothionein-1K; metallothionein-IG
• Gene ID: 4495
• mRNA Refseq: NM_005950
• Protein Refseq: NP_005941
• MIM: 156353
• UniProt ID: P13640
• Chromosome Location: 16q13
• Pathway: Mineral absorption
• Function: protein binding; zinc ion binding