"MT1G" Related Products

Recombinant Human MT1G, GST-tagged

Cat.No.: MT1G-126H
Product Overview: Recombinant Human MT1G(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Metallothionein-1G is a protein that in humans is encoded by the MT1G gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 32.5 kDa
AA Sequence: MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MT1G metallothionein 1G [ Homo sapiens (human) ]
Official Symbol: MT1G
Synonyms: MT1G; MT1; MT1K; metallothionein 1G; metallothionein-1G; MT-1G; MT-1K; MT-IG; metallothionein 1K; metallothionein-1K; metallothionein-IG
Gene ID: 4495
mRNA Refseq: NM_005950
Protein Refseq: NP_005941
MIM: 156353
UniProt ID: P13640
Chromosome Location: 16q13
Pathway: Mineral absorption
Function: protein binding; zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.