Recombinant Human MT1G, GST-tagged
Cat.No. : | MT1G-126H |
Product Overview : | Recombinant Human MT1G(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Metallothionein-1G is a protein that in humans is encoded by the MT1G gene. |
Molecular Mass : | 32.5 kDa |
AA Sequence : | MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MT1G metallothionein 1G [ Homo sapiens (human) ] |
Official Symbol | MT1G |
Synonyms | MT1G; MT1; MT1K; metallothionein 1G; metallothionein-1G; MT-1G; MT-1K; MT-IG; metallothionein 1K; metallothionein-1K; metallothionein-IG |
Gene ID | 4495 |
mRNA Refseq | NM_005950 |
Protein Refseq | NP_005941 |
MIM | 156353 |
UniProt ID | P13640 |
Chromosome Location | 16q13 |
Pathway | Mineral absorption |
Function | protein binding; zinc ion binding |
◆ Recombinant Proteins | ||
MT1G-5316H | Recombinant Human MT1G protein, GST-tagged | +Inquiry |
MT1G-316HF | Recombinant Full Length Human MT1G Protein, GST-tagged | +Inquiry |
MT1G-70H | Recombinant Human MT1G protein | +Inquiry |
MT1G-126H | Recombinant Human MT1G, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT1G-4101HCL | Recombinant Human MT1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT1G Products
Required fields are marked with *
My Review for All MT1G Products
Required fields are marked with *