Recombinant Human MT1G, GST-tagged

Cat.No. : MT1G-126H
Product Overview : Recombinant Human MT1G(1 a.a. - 61 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Metallothionein-1G is a protein that in humans is encoded by the MT1G gene.
Molecular Mass : 32.5 kDa
AA Sequence : MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MT1G metallothionein 1G [ Homo sapiens (human) ]
Official Symbol MT1G
Synonyms MT1G; MT1; MT1K; metallothionein 1G; metallothionein-1G; MT-1G; MT-1K; MT-IG; metallothionein 1K; metallothionein-1K; metallothionein-IG
Gene ID 4495
mRNA Refseq NM_005950
Protein Refseq NP_005941
MIM 156353
UniProt ID P13640
Chromosome Location 16q13
Pathway Mineral absorption
Function protein binding; zinc ion binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT1G Products

Required fields are marked with *

My Review for All MT1G Products

Required fields are marked with *

0
cart-icon