Recombinant Human MTL5, GST-tagged
Cat.No. : | MTL5-134H |
Product Overview : | Recombinant Human MTL5(399 a.a. - 508 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | GCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKE HCSKCLAEQMILEEFGRCLSQILHTEFKSKGLKME |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTL5 metallothionein-like 5, testis-specific (tesmin) [ Homo sapiens (human) ] |
Official Symbol | MTL5 |
Synonyms | MTL5; MTLT; CXCDC2; TESMIN; metallothionein-like 5, testis-specific (tesmin); tesmin; CXC domain containing 2; testis-specific metallothionein-like protein |
Gene ID | 9633 |
mRNA Refseq | NM_004923 |
Protein Refseq | NP_004914 |
MIM | 604374 |
UniProt ID | Q9Y4I5 |
Chromosome Location | 11q13.2-q13.3 |
Function | metal ion binding |
◆ Recombinant Proteins | ||
MTL5-134H | Recombinant Human MTL5, GST-tagged | +Inquiry |
MTL5-3470R | Recombinant Rat MTL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTL5-3811R | Recombinant Rat MTL5 Protein | +Inquiry |
MTL5-133H | Recombinant Human MTL5, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTL5 Products
Required fields are marked with *
My Review for All MTL5 Products
Required fields are marked with *