Recombinant Human MTL5, GST-tagged

• Cat.No.: MTL5-133H
• Product Overview: Recombinant Human MTL5(1 a.a. - 306 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 58.7 kDa
• AA Sequence: MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADC KGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASH PGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCID NSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPP KITLAG
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTL5 metallothionein-like 5, testis-specific (tesmin) [ Homo sapiens (human) ]
• Official Symbol: MTL5
• Synonyms: MTL5; MTLT; CXCDC2; TESMIN; metallothionein-like 5, testis-specific (tesmin); tesmin; CXC domain containing 2; testis-specific metallothionein-like protein
• Gene ID: 9633
• mRNA Refseq: NM_001039656
• Protein Refseq: NP_001034745
• MIM: 604374
• UniProt ID: Q9Y4I5
• Chromosome Location: 11q13.2-q13.3
• Function: metal ion binding