"UOX" Related Products

Expand

Recombinant Aspergillus flavus UOX therapeutic protein

Cat.No.: UOX-P046A
Product Overview: Recombinant urate-oxidase enzyme is produced by a genetically modified Saccharomyces cerevisiae strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.
Description: Our expression product is the active ingredient of Elitek and Fasturtec.
Source: Saccharomyces cerevisiae
Species: Aspergillus flavus
Molecular Mass: 34.1 Kda
Protein length: 301aa
AA Sequence: SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSIKNTIYITAKQN PVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSFIRDSEEKRNVQVDVVEGKGIDI KSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATARE VTLKTFAEDNSASVQATMYKMAEQILARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDP NGLIKCTVGRSSLKSKL
Endotoxin: < 1.0 EU per μg of the protein
Purity: >95%
Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.